KEGG   Bifidobacterium breve 12L: B12L_1514
Entry
B12L_1514         CDS       T03118                                 

Name
(GenBank) phosphotransferase family
  KO
K13059  N-acetylhexosamine 1-kinase [EC:2.7.1.162]
Organism
bbre  Bifidobacterium breve 12L
Brite
KEGG Orthology (KO) [BR:bbre00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    B12L_1514
Enzymes [BR:bbre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.162  N-acetylhexosamine 1-kinase
     B12L_1514
SSDB
Motif
Pfam: APH Choline_kinase
Other DBs
NCBI-ProteinID: AHJ16242
LinkDB
Position
complement(1817054..1818124)
AA seq 356 aa
MAANQETLFDIASHFALEGNIISVEPYGDGHINTTYLVVTDGPHYILQRMNTSIFPDTVN
LMRNVELVTSALKARGKETLDIVPTTSGATWEEIDGGAWRVYKFIEHTVSYNLVPNPDVF
REAGRAFGDFQNFLSGFDAGQLTETIAHFHDTPHRFEDFKAALASDKLGRAASCQPEIDF
YLAHADQYATVMDGLKDGSIPLRVTHNDTKLNNILMDATTGKARAIIDLDTIMPGSMLFD
FGDSIRFGASTALEDEKDLDKVHFSTELFRAYAEGFVGELRGSITEREAELLAFSGNLLT
MECGMRFLADYLEGDVYFATKYPEHNLVRTRTQIKLVQEMEQKVDETHAIVADIMK
NT seq 1071 nt   +upstreamnt  +downstreamnt
atggccgcaaaccaggaaacactatttgacatcgcctcacacttcgcactggagggcaat
atcatcagcgtcgagccttatggcgacggacacatcaacaccacttatctggtggtcact
gatggcccccattacatcctgcagcggatgaacaccagcattttccccgatacggtaaat
ctgatgcgcaatgtcgaactagttacttctgccctcaaagctcggggcaaggagacattg
gatatcgtgcccaccacttccggcgcaacgtgggaagagatcgatggcggtgcgtggcgt
gtatacaaattcatcgagcacaccgtgtcttacaatctcgtgccgaatccagatgtattc
cgtgaggccggcagggcattcggcgacttccaaaatttcctgtccgggttcgatgccggt
cagttgaccgaaaccatcgcgcacttccacgacacccctcatcgttttgaggatttcaag
gccgcccttgcctcggacaagctcggccgtgccgcaagctgccagccggagattgacttc
tatctggcccatgctgatcagtatgccaccgtgatggatggattgaaggacggctcgatt
ccgctgcgtgtgactcataacgacaccaagctgaacaacattctcatggatgccaccacc
ggaaaggcgcgtgcgatcatcgacctcgacaccatcatgccgggctcaatgctgttcgat
ttcggtgattcgattcgctttggagcctccactgctttggaagatgagaaagatttggac
aaagtgcatttcagcaccgagctgttccgtgcttacgccgaaggttttgtgggggagctg
cgcggcagcatcaccgagcgcgaggccgagctgttggctttcagcggcaacctgctcacc
atggaatgcggcatgcgtttcctcgccgattatctggagggcgacgtgtactttgccacg
aagtatcctgagcacaatctggtacgtacccgtacccagatcaagctggtgcaggagatg
gagcagaaggttgatgagacgcacgccatcgttgcggacatcatgaaatag

DBGET integrated database retrieval system