Bordetella bronchialis: BAU06_07885 Help Entry BAU06_07885       CDS       T04591                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bbro  Bordetella bronchialis Pathway bbro00998   Biosynthesis of various antibiotics bbro01100   Metabolic pathways bbro01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bbro00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BAU06_07885    00074 Mycolic acid biosynthesis     BAU06_07885   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BAU06_07885 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 DUF1896 HLH Ribosomal_L50 EutQ DUF1493 Motif Other DBs NCBI-ProteinID:  ANN66221 UniProt:  A0A193FGA8 LinkDB All DBs Position 1772948..1773187 Genome browser AA seq 79 aa AA seqDB search MESIEQRVKKIVAEQLGVNEAEIKNESSFLDDLGADSLDMVELVMALEDEFETEIPDEEA EKITTVQQAIDYINSHGKQ NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggaaagcatcgaacagcgcgtcaagaagatcgtcgctgaacaacttggcgtcaatgaa gccgagatcaagaacgaatcttcctttcttgacgacctcggtgccgattcgctcgacatg gttgagctggtcatggccctcgaagacgaattcgagaccgagatccccgacgaagaggcc gagaaaatcacgaccgtgcaacaagcgattgactacatcaattcgcacggcaagcaataa

DBGET integrated database retrieval system