Bordetella bronchialis: BAU06_10095 Help Entry BAU06_10095       CDS       T04591                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism bbro  Bordetella bronchialis Pathway bbro00998   Biosynthesis of various antibiotics bbro01100   Metabolic pathways bbro01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bbro00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BAU06_10095    00074 Mycolic acid biosynthesis     BAU06_10095   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BAU06_10095 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ANN66594 UniProt:  A0A193FWE0 LinkDB All DBs Position complement(2238642..2238902) Genome browser AA seq 86 aa AA seqDB search MEQLESEIKQLIIEALGLEDIAPEDIASDADLFGDGLGLDSVDALELGLALQKRYGIAID PETRNMRDHFATVANLSKFVHAQRGA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atggaacagctggaaagtgaaatcaagcaactgatcatcgaggccctgggcctggaggac attgcgcccgaagacatcgccagcgatgcggacctgttcggcgacggcctggggctggat tcggtggacgcgctggagcttggcctggccctgcagaagcgctacggcatcgccatcgat ccggaaacgcgtaatatgcgcgaccacttcgccacggtggccaatctgagcaaattcgtc cacgcccagcggggcgcctga

DBGET integrated database retrieval system