Brettanomyces bruxellensis: BRETT_002055 Help Entry BRETT_002055      CDS       T07183                                  Symbol LSM5 Name (RefSeq) RNA-binding protein lsm5   KO K12624   U6 snRNA-associated Sm-like protein LSm5 Organism bbrx  Brettanomyces bruxellensis Pathway bbrx03018   RNA degradation bbrx03040   Spliceosome Brite KEGG Orthology (KO) [BR:bbrx00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     BRETT_002055 (LSM5)   09123 Folding, sorting and degradation    03018 RNA degradation     BRETT_002055 (LSM5)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:bbrx03019]     BRETT_002055 (LSM5)    03041 Spliceosome [BR:bbrx03041]     BRETT_002055 (LSM5) Messenger RNA biogenesis [BR:bbrx03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      BRETT_002055 (LSM5)   mRNA degradation factors    5'-3' decay     Lsm complex      BRETT_002055 (LSM5) Spliceosome [BR:bbrx03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     BRETT_002055 (LSM5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM Motif Other DBs NCBI-GeneID:  64573979 NCBI-ProteinID:  XP_041138384 UniProt:  A0A871RHJ2 LinkDB All DBs Position 9:complement(393171..393452) Genome browser AA seq 93 aa AA seqDB search MSAENKETQDTEVPQILPLELIDKSIGTKIWAIMSDFHEFVGTLEGFDDFVNIVLSDVTE YDVSKKVVSKKSKMLLSSRNLAMLVPGGDGPDF NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgtcggctgaaaacaaggaaacacaggacacggaagtgccacaaattctaccgttagaa cttattgataagagcattggtacaaaaatatgggcaatcatgtctgattttcacgaattc gtggggaccttagaaggattcgatgatttcgttaatatagtgttgagtgatgtgacagag tatgacgtttcgaaaaaagtggtgtcaaaaaaatctaagatgcttctatcatcgaggaat cttgcaatgcttgttccaggaggagacggaccggatttttag

DBGET integrated database retrieval system