Brettanomyces bruxellensis: BRETT_004245 Help Entry BRETT_004245      CDS       T07183                                  Symbol TFB5 Name (RefSeq) TFIIH complex subunit tfb5   KO K10845   TFIIH basal transcription factor complex TTD-A subunit Organism bbrx  Brettanomyces bruxellensis Pathway bbrx03022   Basal transcription factors bbrx03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:bbrx00001]  09120 Genetic Information Processing   09121 Transcription    03022 Basal transcription factors     BRETT_004245 (TFB5)   09124 Replication and repair    03420 Nucleotide excision repair     BRETT_004245 (TFB5)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:bbrx03021]     BRETT_004245 (TFB5)    03400 DNA repair and recombination proteins [BR:bbrx03400]     BRETT_004245 (TFB5) Transcription machinery [BR:bbrx03021]  Eukaryotic type   RNA polymerase II system    Basal transcription factors     TFIIH      BRETT_004245 (TFB5) DNA repair and recombination proteins [BR:bbrx03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TFIIH complex      BRETT_004245 (TFB5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tfb5 Motif Other DBs NCBI-GeneID:  64576168 NCBI-ProteinID:  XP_041135517 UniProt:  A0A3F2Y4L0 LinkDB All DBs Position 5:complement(508583..508801) Genome browser AA seq 72 aa AA seqDB search MARAIKGSLVQCDPSIKALIVNIDAEYKDIVIEELDDTHLLVDPAKIPFIKRELNILLSK NMYNPDDEVQVS NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atggctagagcaattaaagggagcttggttcagtgtgacccttctataaaggcgctaatt gtgaatattgatgcagaatacaaggatattgtgattgaagaacttgacgacactcatctt cttgtcgatccggcaaagattccattcataaagagggaattaaacattttattgtcgaag aacatgtacaatcctgacgacgaggtacaggtttcatag

DBGET integrated database retrieval system