Bubalus bubalis (water buffalo): 102389565 Help Entry 102389565         CDS       T05912                                  Symbol CSNK2B Name (RefSeq) casein kinase II subunit beta   KO K03115   casein kinase II subunit beta Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub03008   Ribosome biogenesis in eukaryotes bbub03083   Polycomb repressive complex bbub04064   NF-kappa B signaling pathway bbub04137   Mitophagy - animal bbub04310   Wnt signaling pathway bbub04520   Adherens junction bbub05010   Alzheimer disease bbub05020   Prion disease bbub05022   Pathways of neurodegeneration - multiple diseases bbub05162   Measles bbub05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:bbub00001]  09120 Genetic Information Processing   09122 Translation    03008 Ribosome biogenesis in eukaryotes     102389565 (CSNK2B)   09126 Chromosome    03083 Polycomb repressive complex     102389565 (CSNK2B)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     102389565 (CSNK2B)    04064 NF-kappa B signaling pathway     102389565 (CSNK2B)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     102389565 (CSNK2B)   09144 Cellular community - eukaryotes    04520 Adherens junction     102389565 (CSNK2B)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102389565 (CSNK2B)   09172 Infectious disease: viral    05162 Measles     102389565 (CSNK2B)   09164 Neurodegenerative disease    05010 Alzheimer disease     102389565 (CSNK2B)    05020 Prion disease     102389565 (CSNK2B)    05022 Pathways of neurodegeneration - multiple diseases     102389565 (CSNK2B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03009 Ribosome biogenesis [BR:bbub03009]     102389565 (CSNK2B)    03036 Chromosome and associated proteins [BR:bbub03036]     102389565 (CSNK2B) Ribosome biogenesis [BR:bbub03009]  Eukaryotic type   90S particles    Kinase     102389565 (CSNK2B) Chromosome and associated proteins [BR:bbub03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.3/1.5)      102389565 (CSNK2B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CK_II_beta Motif Other DBs NCBI-GeneID:  102389565 NCBI-ProteinID:  XP_006041983 LinkDB All DBs Position 2:24804955..24808951 Genome browser AA seq 215 aa AA seqDB search MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDE ELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPML PIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPA NQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgagcagctcagaggaggtgtcctggatttcctggttctgtgggctccgtggtaatgaa ttcttctgtgaggtggatgaagactatatccaggacaaattcaatctcactggactcaat gagcaggtgcctcactatcgacaagctttagacatgatcttggacctggagcctgatgag gagctggaagacaaccccaaccagagtgacctgattgagcaagcagctgaaatgctctat ggattgatccacgcccgctatatcctcaccaaccgtggcattgcccagatgttggaaaag taccagcagggagactttggatactgtccccgtgtgtactgtgagaaccagccaatgctt cccatcggcctttcagacatcccaggtgaggccatggtgaagctctactgccccaagtgc atggacgtgtacacacccaagtcatcgaggcaccaccacacggatggcgcctacttcggc accggtttccctcacatgctcttcatggtgcaccccgagtaccggcccaagaggcccgcc aaccagtttgtgcccaggctttacggtttcaagatccatccaatggcctaccagctgcag ctccaagccgccagcaacttcaagagcccagtgaagacgattcgctga

DBGET integrated database retrieval system