Bubalus bubalis (water buffalo): 102391078 Help Entry 102391078         CDS       T05912                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub04613   Neutrophil extracellular trap formation bbub05034   Alcoholism bbub05203   Viral carcinogenesis bbub05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bbub00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102391078  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     102391078   09163 Immune disease    05322 Systemic lupus erythematosus     102391078   09165 Substance dependence    05034 Alcoholism     102391078  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bbub03036]     102391078 Chromosome and associated proteins [BR:bbub03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102391078 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HIGH_NTase1_ass Motif Other DBs NCBI-GeneID:  102391078 NCBI-ProteinID:  XP_025149897 LinkDB All DBs Position 9:63625889..63626188 Genome browser AA seq 99 aa AA seqDB search MSGRGKGSKGLGKGGAKRHCKVLCDNIQGITKPAIRRLARRGGVKRVSGLIYEETCRVLK VFLENVIRDMVTYTEHSRLRAGIREVPCMQMASLNLSSV NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgcggcaaaggcagcaaaggtctggggaaaggcggtgctaagcgccactgc aaggttctgtgtgacaacatccagggcatcactaaacctgctatccgccgcctggctcgt cgtggtggtgtgaagcgcgtctccgggctcatctatgaagagacctgcagggtcctgaaa gtgtttctggagaacgtgatccgggacatggtcacctacaccgagcattcccgactgaga gctggcatcagggaagtgccctgcatgcagatggcttcattgaacttgagttctgtataa

DBGET integrated database retrieval system