Bubalus bubalis (water buffalo): 102392196 Help Entry 102392196         CDS       T05912                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub04137   Mitophagy - animal bbub04140   Autophagy - animal bbub04144   Endocytosis bbub04145   Phagosome bbub04148   Efferocytosis bbub05132   Salmonella infection bbub05146   Amoebiasis bbub05152   Tuberculosis Brite KEGG Orthology (KO) [BR:bbub00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102392196 (RAB7A)    04145 Phagosome     102392196 (RAB7A)    04140 Autophagy - animal     102392196 (RAB7A)    04137 Mitophagy - animal     102392196 (RAB7A)    04148 Efferocytosis     102392196 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102392196 (RAB7A)    05152 Tuberculosis     102392196 (RAB7A)   09174 Infectious disease: parasitic    05146 Amoebiasis     102392196 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bbub04131]     102392196 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bbub04147]     102392196 (RAB7A)    04031 GTP-binding proteins [BR:bbub04031]     102392196 (RAB7A) Membrane trafficking [BR:bbub04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     102392196 (RAB7A) Exosome [BR:bbub04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102392196 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    102392196 (RAB7A)   Exosomal proteins of colorectal cancer cells    102392196 (RAB7A)   Exosomal proteins of bladder cancer cells    102392196 (RAB7A) GTP-binding proteins [BR:bbub04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     102392196 (RAB7A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_16 AAA_24 G-alpha AAA_5 ATPase_2 NACHT AAA_14 NB-ARC SRPRB ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  102392196 NCBI-ProteinID:  XP_025128250 LinkDB All DBs Position 21:complement(59055500..59101480) Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRTKPSAEGCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacctcgaggaagaaagtgctgctgaaggtgatcatcctgggagactctggagtcggg aagacctcactcatgaaccagtacgtgaacaagaagttcagtaaccagtacaaagccaca atcggagccgacttcctgacgaaggaggtgatggtggacgacaggctagtgaccatgcag atttgggacacggcgggacaggagcggttccagtccctgggcgtggccttctacagaggc gccgactgctgcgtcctggtgttcgacgtgaccgcccccaacacgttcaagacccttgac agctggagagacgagtttctcatccaggccagtccccgggaccccgagaacttccccttt gtcgtgctgggaaacaagattgacctcgaaaacagacaggtggccaccaagcgggcacag gcctggtgctacagcaaaaacaacattccctacttcgagaccagcgccaaggaggccatc aacgtggagcaggccttccagacgatcgcccggaacgcgctcaagcaggaaacggaagtg gagctgtacaacgagttccccgagcccatcaaactggacaagaacgaccgcaccaagccc tcggctgagggctgcagctgctga

DBGET integrated database retrieval system