Bubalus bubalis (water buffalo): 102393071 Help Entry 102393071         CDS       T05912                                  Symbol CCL22 Name (RefSeq) C-C motif chemokine 22   KO K21095   C-C motif chemokine 22 Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub04060   Cytokine-cytokine receptor interaction bbub04061   Viral protein interaction with cytokine and cytokine receptor bbub04062   Chemokine signaling pathway bbub04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:bbub00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102393071 (CCL22)    04061 Viral protein interaction with cytokine and cytokine receptor     102393071 (CCL22)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102393071 (CCL22)    04062 Chemokine signaling pathway     102393071 (CCL22)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bbub04052]     102393071 (CCL22) Cytokines and neuropeptides [BR:bbub04052]  Cytokines   Chemokines    102393071 (CCL22) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  102393071 NCBI-ProteinID:  XP_006059122 LinkDB All DBs Position 18:24978048..24985863 Genome browser AA seq 93 aa AA seqDB search MASLQTPLLAALILLAMILQATEAGPYGANVEDSVCCRDYIRYPLPLRLVKYYYWTSNSC RRPGVVLLTVKDREICADPKQHWVKKILQKLNQ NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggccagcctgcagacccctctcctggctgccctcatcctcctggctatgatacttcaa gcaacagaggcaggcccctacggtgccaacgtggaggacagcgtctgttgccgggactac atccgttaccctctgcccctgcgtttggtgaaatattactactggacttcaaattcctgc cggagacctggcgtggtcttgctgactgtgaaggaccgagagatctgtgctgaccccaaa cagcactgggtgaagaagattctccagaagctgaaccaatga

DBGET integrated database retrieval system