Bubalus bubalis (water buffalo): 102393421 Help Entry 102393421         CDS       T05912                                  Name (RefSeq) calmodulin-1-like   KO K02183   calmodulin Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub04014   Ras signaling pathway bbub04015   Rap1 signaling pathway bbub04020   Calcium signaling pathway bbub04022   cGMP-PKG signaling pathway bbub04024   cAMP signaling pathway bbub04070   Phosphatidylinositol signaling system bbub04114   Oocyte meiosis bbub04218   Cellular senescence bbub04261   Adrenergic signaling in cardiomyocytes bbub04270   Vascular smooth muscle contraction bbub04371   Apelin signaling pathway bbub04625   C-type lectin receptor signaling pathway bbub04713   Circadian entrainment bbub04720   Long-term potentiation bbub04722   Neurotrophin signaling pathway bbub04728   Dopaminergic synapse bbub04740   Olfactory transduction bbub04744   Phototransduction bbub04750   Inflammatory mediator regulation of TRP channels bbub04910   Insulin signaling pathway bbub04912   GnRH signaling pathway bbub04915   Estrogen signaling pathway bbub04916   Melanogenesis bbub04921   Oxytocin signaling pathway bbub04922   Glucagon signaling pathway bbub04924   Renin secretion bbub04925   Aldosterone synthesis and secretion bbub04970   Salivary secretion bbub04971   Gastric acid secretion bbub05010   Alzheimer disease bbub05012   Parkinson disease bbub05022   Pathways of neurodegeneration - multiple diseases bbub05031   Amphetamine addiction bbub05034   Alcoholism bbub05133   Pertussis bbub05152   Tuberculosis bbub05163   Human cytomegalovirus infection bbub05167   Kaposi sarcoma-associated herpesvirus infection bbub05170   Human immunodeficiency virus 1 infection bbub05200   Pathways in cancer bbub05214   Glioma bbub05417   Lipid and atherosclerosis bbub05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:bbub00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102393421    04015 Rap1 signaling pathway     102393421    04371 Apelin signaling pathway     102393421    04020 Calcium signaling pathway     102393421    04070 Phosphatidylinositol signaling system     102393421    04024 cAMP signaling pathway     102393421    04022 cGMP-PKG signaling pathway     102393421  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     102393421    04218 Cellular senescence     102393421  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102393421   09152 Endocrine system    04910 Insulin signaling pathway     102393421    04922 Glucagon signaling pathway     102393421    04912 GnRH signaling pathway     102393421    04915 Estrogen signaling pathway     102393421    04921 Oxytocin signaling pathway     102393421    04916 Melanogenesis     102393421    04924 Renin secretion     102393421    04925 Aldosterone synthesis and secretion     102393421   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     102393421    04270 Vascular smooth muscle contraction     102393421   09154 Digestive system    04970 Salivary secretion     102393421    04971 Gastric acid secretion     102393421   09156 Nervous system    04728 Dopaminergic synapse     102393421    04720 Long-term potentiation     102393421    04722 Neurotrophin signaling pathway     102393421   09157 Sensory system    04744 Phototransduction     102393421    04740 Olfactory transduction     102393421    04750 Inflammatory mediator regulation of TRP channels     102393421   09159 Environmental adaptation    04713 Circadian entrainment     102393421  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102393421   09162 Cancer: specific types    05214 Glioma     102393421   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102393421    05163 Human cytomegalovirus infection     102393421    05167 Kaposi sarcoma-associated herpesvirus infection     102393421   09171 Infectious disease: bacterial    05133 Pertussis     102393421    05152 Tuberculosis     102393421   09164 Neurodegenerative disease    05010 Alzheimer disease     102393421    05012 Parkinson disease     102393421    05022 Pathways of neurodegeneration - multiple diseases     102393421   09165 Substance dependence    05031 Amphetamine addiction     102393421    05034 Alcoholism     102393421   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102393421    05418 Fluid shear stress and atherosclerosis     102393421  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:bbub01009]     102393421   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bbub04131]     102393421    03036 Chromosome and associated proteins [BR:bbub03036]     102393421   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bbub04147]     102393421 Protein phosphatases and associated proteins [BR:bbub01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      102393421 Membrane trafficking [BR:bbub04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     102393421 Chromosome and associated proteins [BR:bbub03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      102393421 Exosome [BR:bbub04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    102393421 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF_EFCAB10_C EH SPARC_Ca_bdg UPF0154 EFhand_Ca_insen EF-hand_11 Dockerin_1 TerB Caleosin DUF1103 FCaBP_EF-hand DUF5580_M SPEF2_C Flagellar_rod PA_Ig-like Motif Other DBs NCBI-GeneID:  102393421 NCBI-ProteinID:  XP_006043080 LinkDB All DBs Position 8:32362864..32364359 Genome browser AA seq 149 aa AA seqDB search MADQLTEEQIAEFKEAFSLFDKDGDGTITAKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDE EVDEMIREADIDGDRQVNYEEFVQMMTAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggctgatcagctgaccgaagagcagattgctgaattcaaggaagctttctccctgttt gacaaagatggtgatggcaccatcacagccaaggaacttggaaccgtcatgaggtcgttg ggccagaacccaacagaagccgaattgcaggacatgatcaacgaggtggacgctgatggt aatggcaccattgacttcccagaatttttgactatgatggctagaaaaatgaaagacacc gacagtgaagaagaaatccgcgaggcattccgagtctttgataaggatggcaacggttac atcagcgccgcagagctccgccacgtcatgacaaacctgggagagaaactaacagatgag gaagtagatgagatgatcagagaagcagacatcgatggagacaggcaagtcaactacgaa gaattcgtacagatgatgactgcaaaatga

DBGET integrated database retrieval system