Bubalus bubalis (water buffalo): 102393701 Help Entry 102393701         CDS       T05912                                  Name (RefSeq) interferon alpha-F   KO K05414   interferon alpha Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub04060   Cytokine-cytokine receptor interaction bbub04151   PI3K-Akt signaling pathway bbub04217   Necroptosis bbub04620   Toll-like receptor signaling pathway bbub04621   NOD-like receptor signaling pathway bbub04622   RIG-I-like receptor signaling pathway bbub04623   Cytosolic DNA-sensing pathway bbub04630   JAK-STAT signaling pathway bbub04650   Natural killer cell mediated cytotoxicity bbub04936   Alcoholic liver disease bbub05152   Tuberculosis bbub05160   Hepatitis C bbub05161   Hepatitis B bbub05162   Measles bbub05163   Human cytomegalovirus infection bbub05164   Influenza A bbub05165   Human papillomavirus infection bbub05167   Kaposi sarcoma-associated herpesvirus infection bbub05168   Herpes simplex virus 1 infection bbub05169   Epstein-Barr virus infection bbub05170   Human immunodeficiency virus 1 infection bbub05171   Coronavirus disease - COVID-19 bbub05200   Pathways in cancer bbub05320   Autoimmune thyroid disease bbub05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bbub00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102393701    04151 PI3K-Akt signaling pathway     102393701   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102393701  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102393701  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102393701    04621 NOD-like receptor signaling pathway     102393701    04622 RIG-I-like receptor signaling pathway     102393701    04623 Cytosolic DNA-sensing pathway     102393701    04650 Natural killer cell mediated cytotoxicity     102393701  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102393701   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102393701    05161 Hepatitis B     102393701    05160 Hepatitis C     102393701    05171 Coronavirus disease - COVID-19     102393701    05164 Influenza A     102393701    05162 Measles     102393701    05168 Herpes simplex virus 1 infection     102393701    05163 Human cytomegalovirus infection     102393701    05167 Kaposi sarcoma-associated herpesvirus infection     102393701    05169 Epstein-Barr virus infection     102393701    05165 Human papillomavirus infection     102393701   09171 Infectious disease: bacterial    05152 Tuberculosis     102393701   09163 Immune disease    05320 Autoimmune thyroid disease     102393701   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102393701   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     102393701  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bbub04052]     102393701 Cytokines and neuropeptides [BR:bbub04052]  Cytokines   Interferons    102393701 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  102393701 NCBI-ProteinID:  XP_025137222 LinkDB All DBs Position 3:complement(85351263..85352368) Genome browser AA seq 228 aa AA seqDB search METMGSYLRHRPEGRSSENKESKFSESPTYPGEASARSPMAPAWSLLLALLLLSCNAICS LGCHLPHIHSLANRRVLMLLQQLRRVSPSSCLQDRNDFAFPQEALGGSQLRKAQAISVLH EVTQHTFQLFSTEGSATTWDQSLLDKLRAALDQQLTDLQACLRQEEGLQGAPLLKEDPSL AVRKYFHRLTLYLREKRHSPCAWEVVRAEVMRAFSSSTNLQESFRRKD NT seq 687 nt NT seq  +upstreamnt  +downstreamnt atggaaaccatgggctcctacttaagacacaggcctgaaggaaggtcttcagagaacaaa gagagcaagttctcagagtcacccacctacccaggagaagcatctgcaaggtccccgatg gccccagcctggtccttactcctggccctgctgctgctcagctgcaacgccatctgctct ctgggctgccacctgcctcacatccacagcctggccaacaggagggtcctgatgctcctg caacaactgaggagggtctccccttcctcctgcctgcaggacagaaatgacttcgcattc ccccaggaggcgctgggtggcagccagttgcggaaggctcaagccatctctgtgctccac gaggtgacccagcacaccttccagctcttcagcacagagggctcggccaccacgtgggac cagagcctcctggacaagctccgcgctgcactggatcagcagctcactgacctgcaagcc tgtctgaggcaggaggaggggctgcaaggggctcccctgctcaaggaggaccccagcctg gctgtgaggaaatacttccacagactcactctctatctgcgagagaagagacacagccct tgtgcctgggaggttgtcagagcagaagtcatgagagccttctcttcctcaacaaacttg caggagagtttcaggagaaaggactga

DBGET integrated database retrieval system