Bubalus bubalis (water buffalo): 102395151 Help Entry 102395151         CDS       T05912                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub04613   Neutrophil extracellular trap formation bbub05034   Alcoholism bbub05203   Viral carcinogenesis bbub05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bbub00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102395151  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     102395151   09163 Immune disease    05322 Systemic lupus erythematosus     102395151   09165 Substance dependence    05034 Alcoholism     102395151  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bbub03036]     102395151 Chromosome and associated proteins [BR:bbub03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102395151 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  102395151 NCBI-ProteinID:  XP_025152133 LinkDB All DBs Position 2:complement(20639801..20640248) Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgcggtaaaggcggaaaggggctcgggaaaggtggtgccaagcgccatcgt aaagttctgcgagataatatccagggcattactaagcccgccattcgtcgtctggcccgc cgtggtggtgttaaacggatttctgggctcatctatgaggaaactcgaggggtgctaaag gtgttcctggagaacgtgatccgggacgcggtcacctacaccgagcacgccaagcgcaag actgtcaccgccatggacgtggtctatgcgctcaagcgccagggacgtactctctacggc tttggcggttaa

DBGET integrated database retrieval system