Bubalus bubalis (water buffalo): 102396436 Help Entry 102396436         CDS       T05912                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub04010   MAPK signaling pathway bbub04014   Ras signaling pathway bbub04015   Rap1 signaling pathway bbub04022   cGMP-PKG signaling pathway bbub04066   HIF-1 signaling pathway bbub04068   FoxO signaling pathway bbub04072   Phospholipase D signaling pathway bbub04081   Hormone signaling bbub04114   Oocyte meiosis bbub04140   Autophagy - animal bbub04150   mTOR signaling pathway bbub04151   PI3K-Akt signaling pathway bbub04152   AMPK signaling pathway bbub04211   Longevity regulating pathway bbub04213   Longevity regulating pathway - multiple species bbub04810   Regulation of actin cytoskeleton bbub04910   Insulin signaling pathway bbub04911   Insulin secretion bbub04913   Ovarian steroidogenesis bbub04914   Progesterone-mediated oocyte maturation bbub04917   Prolactin signaling pathway bbub04923   Regulation of lipolysis in adipocytes bbub04930   Type II diabetes mellitus bbub04931   Insulin resistance bbub04932   Non-alcoholic fatty liver disease bbub04940   Type I diabetes mellitus bbub04950   Maturity onset diabetes of the young bbub04960   Aldosterone-regulated sodium reabsorption bbub05010   Alzheimer disease bbub05215   Prostate cancer bbub05415   Diabetic cardiomyopathy Brite KEGG Orthology (KO) [BR:bbub00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102396436 (INS)    04014 Ras signaling pathway     102396436 (INS)    04015 Rap1 signaling pathway     102396436 (INS)    04066 HIF-1 signaling pathway     102396436 (INS)    04068 FoxO signaling pathway     102396436 (INS)    04072 Phospholipase D signaling pathway     102396436 (INS)    04022 cGMP-PKG signaling pathway     102396436 (INS)    04151 PI3K-Akt signaling pathway     102396436 (INS)    04152 AMPK signaling pathway     102396436 (INS)    04150 mTOR signaling pathway     102396436 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     102396436 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102396436 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     102396436 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102396436 (INS)  09150 Organismal Systems   09152 Endocrine system    04911 Insulin secretion     102396436 (INS)    04910 Insulin signaling pathway     102396436 (INS)    04923 Regulation of lipolysis in adipocytes     102396436 (INS)    04913 Ovarian steroidogenesis     102396436 (INS)    04914 Progesterone-mediated oocyte maturation     102396436 (INS)    04917 Prolactin signaling pathway     102396436 (INS)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     102396436 (INS)   09149 Aging    04211 Longevity regulating pathway     102396436 (INS)    04213 Longevity regulating pathway - multiple species     102396436 (INS)  09160 Human Diseases   09162 Cancer: specific types    05215 Prostate cancer     102396436 (INS)   09164 Neurodegenerative disease    05010 Alzheimer disease     102396436 (INS)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     102396436 (INS)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     102396436 (INS)    04940 Type I diabetes mellitus     102396436 (INS)    04950 Maturity onset diabetes of the young     102396436 (INS)    04932 Non-alcoholic fatty liver disease     102396436 (INS)    04931 Insulin resistance     102396436 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bbub04052]     102396436 (INS) Cytokines and neuropeptides [BR:bbub04052]  Neuropeptides   Unclassified    102396436 (INS) SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  102396436 NCBI-ProteinID:  XP_006051533 LinkDB All DBs Position 5:130863416..130864256 Genome browser AA seq 105 aa AA seqDB search MALWTRLVPLLALLALWAPAPARAFVNQHLCGSHLVEALYLVCGERGFFYTPKARREVEG PQVGALELAGGPGAGGLEGPPQKRGIVEQCCASVCSLYQLENYCN NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggccctgtggacacgcctggtccccctgctggccctgctggcgctctgggcccccgcc ccggcccgtgccttcgtcaaccagcacctgtgtggctcccacctggtggaggcgctgtat ctggtgtgcggagagcgcggcttcttctacacgcccaaggcccgccgggaggtggagggc ccccaggtgggggcgctggagctggccggaggcccgggcgcgggcggcctggaggggccc ccgcagaagcgcggcatcgtggagcagtgctgtgccagcgtgtgctctctctaccagctg gagaactactgtaactag

DBGET integrated database retrieval system