Bubalus bubalis (water buffalo): 102396762 Help Entry 102396762         CDS       T05912                                  Symbol GAST Name (RefSeq) gastrin   KO K13768   gastrin Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub04081   Hormone signaling bbub04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:bbub00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     102396762 (GAST)  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     102396762 (GAST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bbub04052]     102396762 (GAST) Cytokines and neuropeptides [BR:bbub04052]  Neuropeptides   GPCR binding    102396762 (GAST) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  102396762 NCBI-ProteinID:  XP_006055846 LinkDB All DBs Position 3:complement(21146170..21148521) Genome browser AA seq 104 aa AA seqDB search MQRLCAHVLILVLALAAFCEASWKPHSQLQDAPIAPGANRGQEPLRMNGLGPASHPRRQL GLQDTPHMVADLSKKRGPWVEEEEAAYGWMDFGRRSAEEGDQHP NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgcagcgactgtgtgcacatgtgctgatcttggtgctggctctggccgccttctgcgaa gcttcttggaagccccactcccagctgcaagatgcgcccatcgctccaggggccaatagg ggccaggagccgctcaggatgaatgggctgggcccagcctcgcacccccggaggcagctg gggcttcaggatacgccacacatggtcgcagacctgtccaagaagcgggggccatgggtg gaggaagaggaagcagcatatggatggatggacttcggccgccgcagtgctgaggaaggg gaccaacatccctga

DBGET integrated database retrieval system