Bubalus bubalis (water buffalo): 102397928 Help Entry 102397928         CDS       T05912                                  Symbol RAB5B Name (RefSeq) ras-related protein Rab-5B   KO K07888   Ras-related protein Rab-5B Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub04014   Ras signaling pathway bbub04137   Mitophagy - animal bbub04144   Endocytosis bbub04145   Phagosome bbub04148   Efferocytosis bbub04962   Vasopressin-regulated water reabsorption bbub05132   Salmonella infection bbub05146   Amoebiasis bbub05152   Tuberculosis Brite KEGG Orthology (KO) [BR:bbub00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102397928 (RAB5B)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102397928 (RAB5B)    04145 Phagosome     102397928 (RAB5B)    04137 Mitophagy - animal     102397928 (RAB5B)    04148 Efferocytosis     102397928 (RAB5B)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     102397928 (RAB5B)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102397928 (RAB5B)    05152 Tuberculosis     102397928 (RAB5B)   09174 Infectious disease: parasitic    05146 Amoebiasis     102397928 (RAB5B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bbub04131]     102397928 (RAB5B)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bbub04147]     102397928 (RAB5B)    04031 GTP-binding proteins [BR:bbub04031]     102397928 (RAB5B) Membrane trafficking [BR:bbub04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     102397928 (RAB5B)  Endosome - Lysosome transport     102397928 (RAB5B) Exosome [BR:bbub04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102397928 (RAB5B)   Exosomal proteins of other body fluids (saliva and urine)    102397928 (RAB5B)   Exosomal proteins of colorectal cancer cells    102397928 (RAB5B)   Exosomal proteins of melanoma cells    102397928 (RAB5B) GTP-binding proteins [BR:bbub04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     102397928 (RAB5B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 Gtr1_RagA RsgA_GTPase AAA_16 Motif Other DBs NCBI-GeneID:  102397928 NCBI-ProteinID:  XP_025139501 LinkDB All DBs Position 4:63027353..63043081 Genome browser AA seq 215 aa AA seqDB search MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQ SVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQR QASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKK LPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atgactagcagaagcacagccaggcccaatgggcagccccaggccagcaaaatatgccag ttcaaactggtcctgctgggtgaatctgcagtggggaaatctagcctggtattacgtttt gtcaaagggcagttccacgagtatcaggagagcaccattggagcggccttccttacccag tctgtttgtctagatgacacgacagtcaagtttgagatctgggacacagctgggcaggag cgataccatagcttggcccccatgtactacagaggtgcccaagctgccattgtggtttat gacattactaatcaggaaaccttcgcccgagcgaagacatgggtaaaagaactacagcga caggccagtcctagcatcgttattgccctggcagggaacaaagctgacctggccaacaag cgcatggtggagtatgaagaggcccaggcgtatgcagatgacaacagcttattgtttatg gagacttcagccaagacagctatgaacgtgaacgatctcttcctggcaatagctaagaag ttgccaaagagtgaaccccagaatctggggggtgcagcaggccgaagccggggtgtggat cttcacgagcagtcccagcagaacaagagccagtgttgtagcaactga

DBGET integrated database retrieval system