KEGG   Bubalus bubalis (water buffalo): 102398087
Entry
102398087         CDS       T05912                                 
Symbol
MRAP
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04927  Cortisol synthesis and secretion
bbub04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    102398087 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102398087 (MRAP)
SSDB
Motif
Pfam: MRAP FixQ
Other DBs
NCBI-GeneID: 102398087
NCBI-ProteinID: XP_006044878
LinkDB
Position
1:complement(47813586..47832186)
AA seq 191 aa
MANRTNISAPYYSYEYYLDYLDLMPVDEKKLRANKHSIVIAFWVSLAAFMVFLFLILLYM
SWSGSPQTRNATQQPPTCPWSLGLNLPLCIWRQPSTPGPHRARSRNQTPEHPGLSSGYNE
RAPQSQHPRDQSCSPLGTSPWWGPTGHQLTSAIPPVSLPCRQNLSMGEPTPQTQVPSESL
FTQQDGQVGQE
NT seq 576 nt   +upstreamnt  +downstreamnt
atggccaacagaaccaacatctctgccccgtactacagctacgaatactacctggactac
ttggacctcatgcccgtggatgagaagaagctgagagccaataaacattcaatcgtcatc
gccttctgggtgagcctggcagctttcatggtttttctcttcctcatccttctctacatg
tcctggtcaggctctccacagacaaggaacgccactcagcagcccccaacatgtccctgg
agtcttggcctcaacctcccgctctgcatctggaggcaacccagcaccccagggccccac
cgagctcggtcgaggaaccagacgccggagcatcccggcctgtccagcggctacaacgag
agagcccctcaatctcagcaccccagggaccaatcctgctctcctctgggaactagccct
tggtggggacccacagggcaccagctgacgtcagcaatacccccagtgagcctcccctgc
agacagaacctctcaatgggagaaccaacaccccaaacccaggtgccctctgaaagcctg
tttacgcagcaggacgggcaagtgggtcaagaatga

DBGET integrated database retrieval system