Bubalus bubalis (water buffalo): 102398160 Help Entry 102398160         CDS       T05912                                  Symbol RRAS Name (RefSeq) ras-related protein R-Ras   KO K07829   Ras-related protein R-Ras Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub04010   MAPK signaling pathway bbub04014   Ras signaling pathway bbub04015   Rap1 signaling pathway bbub04024   cAMP signaling pathway bbub04072   Phospholipase D signaling pathway bbub04137   Mitophagy - animal bbub04140   Autophagy - animal bbub04218   Cellular senescence bbub04360   Axon guidance bbub04371   Apelin signaling pathway bbub04625   C-type lectin receptor signaling pathway bbub04810   Regulation of actin cytoskeleton bbub05132   Salmonella infection bbub05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:bbub00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102398160 (RRAS)    04014 Ras signaling pathway     102398160 (RRAS)    04015 Rap1 signaling pathway     102398160 (RRAS)    04371 Apelin signaling pathway     102398160 (RRAS)    04072 Phospholipase D signaling pathway     102398160 (RRAS)    04024 cAMP signaling pathway     102398160 (RRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102398160 (RRAS)    04137 Mitophagy - animal     102398160 (RRAS)   09143 Cell growth and death    04218 Cellular senescence     102398160 (RRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102398160 (RRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102398160 (RRAS)   09158 Development and regeneration    04360 Axon guidance     102398160 (RRAS)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     102398160 (RRAS)   09171 Infectious disease: bacterial    05132 Salmonella infection     102398160 (RRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:bbub04031]     102398160 (RRAS) GTP-binding proteins [BR:bbub04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     102398160 (RRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 AAA_22 Motif Other DBs NCBI-GeneID:  102398160 NCBI-ProteinID:  XP_006080153 LinkDB All DBs Position 18:complement(55510293..55514060) Genome browser AA seq 218 aa AA seqDB search MSSGAASGTGRGRPRGGVPGPGDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDP TIEDSYTKICTVDGIPARLDILDTAGQEEFGAMREQYMRAGHGFLLVFAINDRQSFNEVG KLFTQILRVKDRDDFPVVLVGNKADLETQRQVPRSEASTFSASHHVAYFEASAKLRLNVD EAFEQLVRAVRKYQEQELPPSPPSAPRKKAGGCPCVLL NT seq 657 nt NT seq  +upstreamnt  +downstreamnt atgagcagcggggcggcgtccgggacagggcgggggcggccccggggcggggtgccggga cccggggaccccccacccagcgagacacacaagctggtggtcgtgggcggcggcggcgtg ggcaagagcgcgctgaccatccagttcatccagtcctacttcgtgtctgactacgacccc actatcgaagactcctacacgaagatctgcactgtggacggcatcccagcccggctagac atcctggacaccgccggccaggaggagtttggtgccatgcgggaacagtacatgcgtgcg ggccacggattcctgctggtgtttgccattaatgacaggcagagtttcaacgaagtgggc aagctcttcacgcagattcttcgagtcaaggaccgagacgacttccccgtcgtgttggtt ggcaacaaggcggatctggaaacacagcgccaggtcccccgatctgaagcctccaccttc agtgcctcccaccacgtggcctacttcgaagcttctgccaaactgcgcctcaacgtggat gaagccttcgagcagctggtgcgggctgtccggaagtaccaggaacaagagctcccgccc tccccacccagcgcccccaggaagaaggccggaggctgcccctgtgtccttctgtag

DBGET integrated database retrieval system