Bubalus bubalis (water buffalo): 102399323 Help Entry 102399323         CDS       T05912                                  Symbol NPPC Name (RefSeq) C-type natriuretic peptide   KO K12336   natriuretic peptide C Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub04022   cGMP-PKG signaling pathway bbub04081   Hormone signaling bbub04270   Vascular smooth muscle contraction bbub05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:bbub00001]  09130 Environmental Information Processing   09132 Signal transduction    04022 cGMP-PKG signaling pathway     102399323 (NPPC)   09133 Signaling molecules and interaction    04081 Hormone signaling     102399323 (NPPC)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     102399323 (NPPC)  09160 Human Diseases   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102399323 (NPPC)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bbub04052]     102399323 (NPPC) Cytokines and neuropeptides [BR:bbub04052]  Neuropeptides   Unclassified    102399323 (NPPC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  102399323 NCBI-ProteinID:  XP_045020556 LinkDB All DBs Position 2:complement(171850431..171855107) Genome browser AA seq 126 aa AA seqDB search MHLSQLLACALLLALLSLRPSEAKPGAPPKVPRTQSGEEVAEPQAVGGGQKKGDKTPGGG GANLKDDRSRLLRDLRVDTKSRAAWTRLLHEHPNARKFKGGNKKGLSKGCFGLKLDRIGS MSGLGC NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcacctctcccagctgctggcctgcgccctgctgctcgcgctactctcgctccggccc tccgaagccaagcccggggcgcctccaaaggtcccgcgaactcagtccggcgaggaggtg gccgagccccaggctgtgggcggcggtcagaagaaaggcgacaagactcccgggggcggc ggcgccaatctcaaggacgaccgatcgcgactgcttcgggacctgcgcgtggacaccaag tcccgggcggcgtggacccgcctcctgcacgagcaccccaacgcgcgcaaattcaaagga ggcaacaagaagggtttgtccaagggctgcttcggcctcaagctggacaggatcggctcc atgagcggcctgggatgttag

DBGET integrated database retrieval system