Bubalus bubalis (water buffalo): 102400361 Help Entry 102400361         CDS       T05912                                  Symbol PFN2 Name (RefSeq) profilin-2 isoform X2   KO K05759   profilin Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub04015   Rap1 signaling pathway bbub04810   Regulation of actin cytoskeleton bbub05014   Amyotrophic lateral sclerosis bbub05132   Salmonella infection Brite KEGG Orthology (KO) [BR:bbub00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     102400361 (PFN2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102400361 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102400361 (PFN2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102400361 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bbub04131]     102400361 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:bbub04812]     102400361 (PFN2)    04147 Exosome [BR:bbub04147]     102400361 (PFN2) Membrane trafficking [BR:bbub04131]  Others   Actin-binding proteins    Others     102400361 (PFN2) Cytoskeleton proteins [BR:bbub04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      102400361 (PFN2) Exosome [BR:bbub04147]  Exosomal proteins   Proteins found in most exosomes    102400361 (PFN2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  102400361 NCBI-ProteinID:  XP_025145807 LinkDB All DBs Position 1:163246333..163253121 Genome browser AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPVEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRALVIVMGKEGVH GGTLNKKAYELALYLRRSDV NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttc cagagcattacgccagtagaaatagatatgattgtaggaaaagaccgggaaggtttcttt accaatggtttgactcttggcgcaaagaagtgctcagtgatcagagatagcctatacgtg gacggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacgtacaac gtggccgtgggcagagctggtagagcattggttatagtcatgggaaaggaaggtgtccac ggaggcacacttaacaagaaagcatatgaactcgctttatacctgaggaggtctgatgtg taa

DBGET integrated database retrieval system