Bubalus bubalis (water buffalo): 102400804 Help Entry 102400804         CDS       T05912                                  Symbol PPP3R2 Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub04010   MAPK signaling pathway bbub04020   Calcium signaling pathway bbub04022   cGMP-PKG signaling pathway bbub04114   Oocyte meiosis bbub04218   Cellular senescence bbub04310   Wnt signaling pathway bbub04360   Axon guidance bbub04370   VEGF signaling pathway bbub04380   Osteoclast differentiation bbub04625   C-type lectin receptor signaling pathway bbub04650   Natural killer cell mediated cytotoxicity bbub04658   Th1 and Th2 cell differentiation bbub04659   Th17 cell differentiation bbub04660   T cell receptor signaling pathway bbub04662   B cell receptor signaling pathway bbub04720   Long-term potentiation bbub04724   Glutamatergic synapse bbub04921   Oxytocin signaling pathway bbub04922   Glucagon signaling pathway bbub04924   Renin secretion bbub05010   Alzheimer disease bbub05014   Amyotrophic lateral sclerosis bbub05020   Prion disease bbub05022   Pathways of neurodegeneration - multiple diseases bbub05031   Amphetamine addiction bbub05152   Tuberculosis bbub05163   Human cytomegalovirus infection bbub05166   Human T-cell leukemia virus 1 infection bbub05167   Kaposi sarcoma-associated herpesvirus infection bbub05170   Human immunodeficiency virus 1 infection bbub05235   PD-L1 expression and PD-1 checkpoint pathway in cancer bbub05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bbub00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102400804 (PPP3R2)    04310 Wnt signaling pathway     102400804 (PPP3R2)    04370 VEGF signaling pathway     102400804 (PPP3R2)    04020 Calcium signaling pathway     102400804 (PPP3R2)    04022 cGMP-PKG signaling pathway     102400804 (PPP3R2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     102400804 (PPP3R2)    04218 Cellular senescence     102400804 (PPP3R2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102400804 (PPP3R2)    04650 Natural killer cell mediated cytotoxicity     102400804 (PPP3R2)    04660 T cell receptor signaling pathway     102400804 (PPP3R2)    04658 Th1 and Th2 cell differentiation     102400804 (PPP3R2)    04659 Th17 cell differentiation     102400804 (PPP3R2)    04662 B cell receptor signaling pathway     102400804 (PPP3R2)   09152 Endocrine system    04922 Glucagon signaling pathway     102400804 (PPP3R2)    04921 Oxytocin signaling pathway     102400804 (PPP3R2)    04924 Renin secretion     102400804 (PPP3R2)   09156 Nervous system    04724 Glutamatergic synapse     102400804 (PPP3R2)    04720 Long-term potentiation     102400804 (PPP3R2)   09158 Development and regeneration    04360 Axon guidance     102400804 (PPP3R2)    04380 Osteoclast differentiation     102400804 (PPP3R2)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102400804 (PPP3R2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102400804 (PPP3R2)    05170 Human immunodeficiency virus 1 infection     102400804 (PPP3R2)    05163 Human cytomegalovirus infection     102400804 (PPP3R2)    05167 Kaposi sarcoma-associated herpesvirus infection     102400804 (PPP3R2)   09171 Infectious disease: bacterial    05152 Tuberculosis     102400804 (PPP3R2)   09164 Neurodegenerative disease    05010 Alzheimer disease     102400804 (PPP3R2)    05014 Amyotrophic lateral sclerosis     102400804 (PPP3R2)    05020 Prion disease     102400804 (PPP3R2)    05022 Pathways of neurodegeneration - multiple diseases     102400804 (PPP3R2)   09165 Substance dependence    05031 Amphetamine addiction     102400804 (PPP3R2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102400804 (PPP3R2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:bbub01009]     102400804 (PPP3R2) Protein phosphatases and associated proteins [BR:bbub01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      102400804 (PPP3R2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9 YtfJ_HI0045 flgK_1st_1 Motif Other DBs NCBI-GeneID:  102400804 NCBI-ProteinID:  XP_006067927 LinkDB All DBs Position 3:complement(152893424..152896171) Genome browser AA seq 170 aa AA seqDB search MGNEASYPAEICSHFDEDEIKRLRKRFKKLDLDSSSALSVKEFTSMPELQGNPLAQRVID VFDTDGDGQVDFREFILGTSQFSVRGDEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMV GDNLKDWQLQQLVDKTIILLDKDGDGKISFQEFSAVVRSLEVHKHLVTIV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgaggccagttacccggcggagatatgctctcactttgacgaagatgaaatt aaaaggctgcgcaagcggtttaagaagctggatttggacagttccagcgctctgagcgtc aaagagttcacgtccatgccggagctgcaggggaacccgctggcgcagcgggtgatcgac gtcttcgacaccgacggcgacggacaggtggacttccgggaattcatcctggggacctcc cagttcagcgtccggggagatgaggagcagaagctgaggtttgctttcagcatctacgac atggacaaagacggctacatttccaacggggagctcttccaggtgctgaagatgatggtg ggggacaacctgaaagactggcagttacagcagctggtggacaaaaccatcatcctcctg gacaaagacggggacgggaaaatctccttccaggaattcagtgctgtggtcagaagcctg gaggtccacaagcacttggtgaccattgtgtga

DBGET integrated database retrieval system