Bubalus bubalis (water buffalo): 102401643 Help Entry 102401643         CDS       T05912                                  Symbol WNT7B Name (RefSeq) protein Wnt-7b   KO K00572   wingless-type MMTV integration site family, member 7 Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub04150   mTOR signaling pathway bbub04310   Wnt signaling pathway bbub04390   Hippo signaling pathway bbub04519   Cadherin signaling bbub04550   Signaling pathways regulating pluripotency of stem cells bbub04916   Melanogenesis bbub04934   Cushing syndrome bbub05010   Alzheimer disease bbub05022   Pathways of neurodegeneration - multiple diseases bbub05165   Human papillomavirus infection bbub05200   Pathways in cancer bbub05205   Proteoglycans in cancer bbub05217   Basal cell carcinoma bbub05224   Breast cancer bbub05225   Hepatocellular carcinoma bbub05226   Gastric cancer Brite KEGG Orthology (KO) [BR:bbub00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     102401643 (WNT7B)    04390 Hippo signaling pathway     102401643 (WNT7B)    04150 mTOR signaling pathway     102401643 (WNT7B)   09133 Signaling molecules and interaction    04519 Cadherin signaling     102401643 (WNT7B)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     102401643 (WNT7B)  09150 Organismal Systems   09152 Endocrine system    04916 Melanogenesis     102401643 (WNT7B)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102401643 (WNT7B)    05205 Proteoglycans in cancer     102401643 (WNT7B)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     102401643 (WNT7B)    05226 Gastric cancer     102401643 (WNT7B)    05217 Basal cell carcinoma     102401643 (WNT7B)    05224 Breast cancer     102401643 (WNT7B)   09172 Infectious disease: viral    05165 Human papillomavirus infection     102401643 (WNT7B)   09164 Neurodegenerative disease    05010 Alzheimer disease     102401643 (WNT7B)    05022 Pathways of neurodegeneration - multiple diseases     102401643 (WNT7B)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     102401643 (WNT7B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    00536 Glycosaminoglycan binding proteins [BR:bbub00536]     102401643 (WNT7B) Glycosaminoglycan binding proteins [BR:bbub00536]  Heparan sulfate / Heparin   Morphogens    102401643 (WNT7B) SSDB OrthologParalogGFIT Motif Pfam:  wnt DUF7259 Motif Other DBs NCBI-GeneID:  102401643 NCBI-ProteinID:  XP_045021127 LinkDB All DBs Position 4:3715244..3737733 Genome browser AA seq 174 aa AA seqDB search MLLLSPRSALLSVYCPQLFLILSSGSYLALSSVVALGANIICNKIPGLAPRQRAICQSRP DAIIVIGEGAQMGINECQYQFRFGRWNCSALGEKTVFGQELRVGKGASGPVGTCRPGCGC RGPGTPSPLGGQAGRARSLFCACWLVPLPSRCCSVPARPSRLWDEAGVSGSQPL NT seq 525 nt NT seq  +upstreamnt  +downstreamnt atgctcctgctgtcgccgcgcagcgcgctgctctccgtgtactgcccgcagctctttctc atcctgtccagcggcagctacctagccctgtcatccgtcgtggccctgggagccaacatc atctgcaacaagattcctggcctggccccgaggcagcgcgccatctgtcagagccggccc gatgccatcatcgtgattggggagggggcgcagatgggcatcaacgagtgccagtaccag ttccgcttcgggcgctggaactgctccgccctcggcgagaagaccgtctttgggcaagag ctccgagtaggtaagggcgcctccgggcccgtgggaacctgccgtccgggctgtgggtgc cgggggccaggcacaccctcgcccttgggaggccaggccggccgcgcccgctcgcttttc tgcgcctgctggctggttcctctgccgtcccggtgctgctctgtgcctgcccggccctcc aggctctgggacgaggcaggtgtctctggaagccagcccctgtga

DBGET integrated database retrieval system