Bubalus bubalis (water buffalo): 102402025 Help Entry 102402025         CDS       T05912                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub04014   Ras signaling pathway bbub04015   Rap1 signaling pathway bbub04022   cGMP-PKG signaling pathway bbub04024   cAMP signaling pathway bbub04062   Chemokine signaling pathway bbub04071   Sphingolipid signaling pathway bbub04072   Phospholipase D signaling pathway bbub04081   Hormone signaling bbub04144   Endocytosis bbub04150   mTOR signaling pathway bbub04270   Vascular smooth muscle contraction bbub04310   Wnt signaling pathway bbub04350   TGF-beta signaling pathway bbub04360   Axon guidance bbub04510   Focal adhesion bbub04520   Adherens junction bbub04530   Tight junction bbub04611   Platelet activation bbub04621   NOD-like receptor signaling pathway bbub04625   C-type lectin receptor signaling pathway bbub04660   T cell receptor signaling pathway bbub04670   Leukocyte transendothelial migration bbub04722   Neurotrophin signaling pathway bbub04810   Regulation of actin cytoskeleton bbub04921   Oxytocin signaling pathway bbub04928   Parathyroid hormone synthesis, secretion and action bbub04972   Pancreatic secretion bbub05100   Bacterial invasion of epithelial cells bbub05132   Salmonella infection bbub05133   Pertussis bbub05135   Yersinia infection bbub05152   Tuberculosis bbub05163   Human cytomegalovirus infection bbub05200   Pathways in cancer bbub05203   Viral carcinogenesis bbub05205   Proteoglycans in cancer bbub05206   MicroRNAs in cancer bbub05210   Colorectal cancer bbub05417   Lipid and atherosclerosis bbub05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:bbub00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102402025 (RHOA)    04015 Rap1 signaling pathway     102402025 (RHOA)    04310 Wnt signaling pathway     102402025 (RHOA)    04350 TGF-beta signaling pathway     102402025 (RHOA)    04072 Phospholipase D signaling pathway     102402025 (RHOA)    04071 Sphingolipid signaling pathway     102402025 (RHOA)    04024 cAMP signaling pathway     102402025 (RHOA)    04022 cGMP-PKG signaling pathway     102402025 (RHOA)    04150 mTOR signaling pathway     102402025 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     102402025 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102402025 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     102402025 (RHOA)    04520 Adherens junction     102402025 (RHOA)    04530 Tight junction     102402025 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102402025 (RHOA)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     102402025 (RHOA)    04621 NOD-like receptor signaling pathway     102402025 (RHOA)    04625 C-type lectin receptor signaling pathway     102402025 (RHOA)    04660 T cell receptor signaling pathway     102402025 (RHOA)    04670 Leukocyte transendothelial migration     102402025 (RHOA)    04062 Chemokine signaling pathway     102402025 (RHOA)   09152 Endocrine system    04921 Oxytocin signaling pathway     102402025 (RHOA)    04928 Parathyroid hormone synthesis, secretion and action     102402025 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     102402025 (RHOA)   09154 Digestive system    04972 Pancreatic secretion     102402025 (RHOA)   09156 Nervous system    04722 Neurotrophin signaling pathway     102402025 (RHOA)   09158 Development and regeneration    04360 Axon guidance     102402025 (RHOA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102402025 (RHOA)    05206 MicroRNAs in cancer     102402025 (RHOA)    05205 Proteoglycans in cancer     102402025 (RHOA)    05203 Viral carcinogenesis     102402025 (RHOA)   09162 Cancer: specific types    05210 Colorectal cancer     102402025 (RHOA)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     102402025 (RHOA)   09171 Infectious disease: bacterial    05132 Salmonella infection     102402025 (RHOA)    05135 Yersinia infection     102402025 (RHOA)    05133 Pertussis     102402025 (RHOA)    05152 Tuberculosis     102402025 (RHOA)    05100 Bacterial invasion of epithelial cells     102402025 (RHOA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102402025 (RHOA)    05418 Fluid shear stress and atherosclerosis     102402025 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bbub04131]     102402025 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bbub04147]     102402025 (RHOA)    04031 GTP-binding proteins [BR:bbub04031]     102402025 (RHOA) Membrane trafficking [BR:bbub04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     102402025 (RHOA) Exosome [BR:bbub04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102402025 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    102402025 (RHOA)   Exosomal proteins of colorectal cancer cells    102402025 (RHOA)   Exosomal proteins of bladder cancer cells    102402025 (RHOA) GTP-binding proteins [BR:bbub04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     102402025 (RHOA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  102402025 NCBI-ProteinID:  XP_025127770 LinkDB All DBs Position 21:50602783..50652969 Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatccggaagaaactggtgattgttggagatggagcctgtggcaagacttgc ttgctcattgtctttagcaaggaccagttcccagaggtgtatgtccctacggtgtttgag aactatgtggcagatattgaagtggatggaaagcaggtagagttggctttgtgggacaca gctgggcaggaagattatgatcgcttgaggcctctctcctacccggataccgacgttata ctgatgtgtttctccattgacagccctgatagtttagaaaacataccagaaaaatggact ccggaagtcaagcatttctgtcccaacgtgcccatcatcctggttgggaacaagaaggat cttcgaaatgacgagcacacaaggcgggagctggccaagatgaagcaggagccagtaaaa cccgaagaaggcagagatatggcaaacaggattggtgcttttgggtacatggagtgttca gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagagctgctctgcaa gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system