Bubalus bubalis (water buffalo): 102402971 Help Entry 102402971         CDS       T05912                                  Symbol CAV3 Name (RefSeq) caveolin-3   KO K12959   caveolin 3 Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub04144   Endocytosis bbub04510   Focal adhesion bbub05020   Prion disease bbub05100   Bacterial invasion of epithelial cells bbub05205   Proteoglycans in cancer bbub05410   Hypertrophic cardiomyopathy bbub05412   Arrhythmogenic right ventricular cardiomyopathy bbub05414   Dilated cardiomyopathy bbub05416   Viral myocarditis bbub05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:bbub00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102402971 (CAV3)   09144 Cellular community - eukaryotes    04510 Focal adhesion     102402971 (CAV3)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     102402971 (CAV3)   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     102402971 (CAV3)   09164 Neurodegenerative disease    05020 Prion disease     102402971 (CAV3)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102402971 (CAV3)    05410 Hypertrophic cardiomyopathy     102402971 (CAV3)    05412 Arrhythmogenic right ventricular cardiomyopathy     102402971 (CAV3)    05414 Dilated cardiomyopathy     102402971 (CAV3)    05416 Viral myocarditis     102402971 (CAV3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bbub04131]     102402971 (CAV3) Membrane trafficking [BR:bbub04131]  Endocytosis   Lipid raft mediated endocytosis    Caveolin-mediated endocytosis     102402971 (CAV3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Caveolin Motif Other DBs NCBI-GeneID:  102402971 NCBI-ProteinID:  XP_006070830 LinkDB All DBs Position 21:complement(17761768..17774338) Genome browser AA seq 151 aa AA seqDB search MMAEEHTDLEAQIVKDIHFKEIDLVNRDPKNINEDIVKVDFEDVIAEPVGTYSFDGVWKV SYTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHI YSLCIRTFCNPLFAALGQVCSNIKVMLRKEV NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgatggccgaggagcacacagacctggaggcccagatcgtcaaggacattcacttcaag gagatcgatctggtgaaccgagaccctaagaacatcaacgaggacatagtgaaggtggat tttgaagacgtgatcgcggagcccgtgggcacctacagctttgacggcgtgtggaaggtg agctacaccaccttcacagtctccaagtactggtgctaccgcctgctgtccacactgctg ggcgtcccactggccctgctctggggcttcctgttcgcctgcatctccttctgccacatc tgggcggtggtgccctgcatcaagagctacctgatcgagatccagtgcatcagtcacatc tactcgctctgcatccgcaccttctgcaacccactcttcgccgccctgggccaggtctgc agcaacatcaaggtgatgctgcggaaggaagtgtga

DBGET integrated database retrieval system