Bubalus bubalis (water buffalo): 102403442 Help Entry 102403442         CDS       T05912                                  Symbol RAB8A Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub04140   Autophagy - animal bbub04144   Endocytosis bbub04152   AMPK signaling pathway bbub04530   Tight junction bbub04972   Pancreatic secretion bbub05014   Amyotrophic lateral sclerosis bbub05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:bbub00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     102403442 (RAB8A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102403442 (RAB8A)    04140 Autophagy - animal     102403442 (RAB8A)   09144 Cellular community - eukaryotes    04530 Tight junction     102403442 (RAB8A)  09150 Organismal Systems   09154 Digestive system    04972 Pancreatic secretion     102403442 (RAB8A)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102403442 (RAB8A)    05022 Pathways of neurodegeneration - multiple diseases     102403442 (RAB8A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bbub04131]     102403442 (RAB8A)    03036 Chromosome and associated proteins [BR:bbub03036]     102403442 (RAB8A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bbub04147]     102403442 (RAB8A)    04031 GTP-binding proteins [BR:bbub04031]     102403442 (RAB8A) Membrane trafficking [BR:bbub04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     102403442 (RAB8A)  Autophagy   Other autophagy associated proteins     102403442 (RAB8A) Chromosome and associated proteins [BR:bbub03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     102403442 (RAB8A) Exosome [BR:bbub04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102403442 (RAB8A)   Exosomal proteins of other body fluids (saliva and urine)    102403442 (RAB8A)   Exosomal proteins of colorectal cancer cells    102403442 (RAB8A) GTP-binding proteins [BR:bbub04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     102403442 (RAB8A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA GTP_EFTU SRPRB MMR_HSR1 Septin DUF3963 AAA_7 Motif Other DBs NCBI-GeneID:  102403442 NCBI-ProteinID:  XP_006057898 LinkDB All DBs Position 9:103478350..103499102 Genome browser AA seq 207 aa AA seqDB search MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG NKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFYTLARDIKAKMDKKLEGN SPQGSNQGVKITPDQQKRSSFFRCVLL NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcgaagacctacgattacctgttcaagctgctgctgatcggggactcgggggtgggg aagacctgtgtcctgttccgcttctccgaggacgccttcaactccactttcatctccacc ataggaattgactttaaaattaggaccatagagctcgatggcaagagaattaagctacag atatgggacacagctggtcaggaacggtttcggacgatcacaacggcctactacaggggt gcaatgggcatcatgctggtctacgacatcaccaacgagaagtcctttgataacatccgg aactggattcggaacattgaagagcacgcctctgcagacgtcgaaaagatgatccttggg aacaagtgtgacgtgaatgacaagagacaagtttccaaggaacggggagaaaagctggcc ctggactatggaatcaagttcatggagacaagcgcaaaggccaacatcaacgtggagaac gcattttacactctcgccagagacatcaaagcaaaaatggataaaaaattggaaggcaac agcccccaggggagcaaccaaggagtcaaaatcaccccggaccagcagaagaggagcagc ttcttccgatgtgttcttctgtga

DBGET integrated database retrieval system