Bubalus bubalis (water buffalo): 102405224 Help Entry 102405224         CDS       T05912                                  Symbol JUN Name (RefSeq) transcription factor AP-1   KO K04448   transcription factor AP-1 Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub01522   Endocrine resistance bbub04010   MAPK signaling pathway bbub04012   ErbB signaling pathway bbub04024   cAMP signaling pathway bbub04137   Mitophagy - animal bbub04210   Apoptosis bbub04310   Wnt signaling pathway bbub04380   Osteoclast differentiation bbub04510   Focal adhesion bbub04530   Tight junction bbub04620   Toll-like receptor signaling pathway bbub04621   NOD-like receptor signaling pathway bbub04625   C-type lectin receptor signaling pathway bbub04657   IL-17 signaling pathway bbub04658   Th1 and Th2 cell differentiation bbub04659   Th17 cell differentiation bbub04660   T cell receptor signaling pathway bbub04662   B cell receptor signaling pathway bbub04668   TNF signaling pathway bbub04722   Neurotrophin signaling pathway bbub04912   GnRH signaling pathway bbub04915   Estrogen signaling pathway bbub04921   Oxytocin signaling pathway bbub04926   Relaxin signaling pathway bbub04932   Non-alcoholic fatty liver disease bbub04933   AGE-RAGE signaling pathway in diabetic complications bbub05030   Cocaine addiction bbub05031   Amphetamine addiction bbub05132   Salmonella infection bbub05133   Pertussis bbub05135   Yersinia infection bbub05140   Leishmaniasis bbub05142   Chagas disease bbub05161   Hepatitis B bbub05162   Measles bbub05166   Human T-cell leukemia virus 1 infection bbub05167   Kaposi sarcoma-associated herpesvirus infection bbub05169   Epstein-Barr virus infection bbub05170   Human immunodeficiency virus 1 infection bbub05171   Coronavirus disease - COVID-19 bbub05200   Pathways in cancer bbub05203   Viral carcinogenesis bbub05207   Chemical carcinogenesis - receptor activation bbub05208   Chemical carcinogenesis - reactive oxygen species bbub05210   Colorectal cancer bbub05211   Renal cell carcinoma bbub05224   Breast cancer bbub05231   Choline metabolism in cancer bbub05235   PD-L1 expression and PD-1 checkpoint pathway in cancer bbub05321   Inflammatory bowel disease bbub05323   Rheumatoid arthritis bbub05417   Lipid and atherosclerosis bbub05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:bbub00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102405224 (JUN)    04012 ErbB signaling pathway     102405224 (JUN)    04310 Wnt signaling pathway     102405224 (JUN)    04668 TNF signaling pathway     102405224 (JUN)    04024 cAMP signaling pathway     102405224 (JUN)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     102405224 (JUN)   09143 Cell growth and death    04210 Apoptosis     102405224 (JUN)   09144 Cellular community - eukaryotes    04510 Focal adhesion     102405224 (JUN)    04530 Tight junction     102405224 (JUN)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102405224 (JUN)    04621 NOD-like receptor signaling pathway     102405224 (JUN)    04625 C-type lectin receptor signaling pathway     102405224 (JUN)    04660 T cell receptor signaling pathway     102405224 (JUN)    04658 Th1 and Th2 cell differentiation     102405224 (JUN)    04659 Th17 cell differentiation     102405224 (JUN)    04657 IL-17 signaling pathway     102405224 (JUN)    04662 B cell receptor signaling pathway     102405224 (JUN)   09152 Endocrine system    04912 GnRH signaling pathway     102405224 (JUN)    04915 Estrogen signaling pathway     102405224 (JUN)    04921 Oxytocin signaling pathway     102405224 (JUN)    04926 Relaxin signaling pathway     102405224 (JUN)   09156 Nervous system    04722 Neurotrophin signaling pathway     102405224 (JUN)   09158 Development and regeneration    04380 Osteoclast differentiation     102405224 (JUN)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102405224 (JUN)    05207 Chemical carcinogenesis - receptor activation     102405224 (JUN)    05208 Chemical carcinogenesis - reactive oxygen species     102405224 (JUN)    05203 Viral carcinogenesis     102405224 (JUN)    05231 Choline metabolism in cancer     102405224 (JUN)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102405224 (JUN)   09162 Cancer: specific types    05210 Colorectal cancer     102405224 (JUN)    05211 Renal cell carcinoma     102405224 (JUN)    05224 Breast cancer     102405224 (JUN)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102405224 (JUN)    05170 Human immunodeficiency virus 1 infection     102405224 (JUN)    05161 Hepatitis B     102405224 (JUN)    05171 Coronavirus disease - COVID-19     102405224 (JUN)    05162 Measles     102405224 (JUN)    05167 Kaposi sarcoma-associated herpesvirus infection     102405224 (JUN)    05169 Epstein-Barr virus infection     102405224 (JUN)   09171 Infectious disease: bacterial    05132 Salmonella infection     102405224 (JUN)    05135 Yersinia infection     102405224 (JUN)    05133 Pertussis     102405224 (JUN)   09174 Infectious disease: parasitic    05140 Leishmaniasis     102405224 (JUN)    05142 Chagas disease     102405224 (JUN)   09163 Immune disease    05323 Rheumatoid arthritis     102405224 (JUN)    05321 Inflammatory bowel disease     102405224 (JUN)   09165 Substance dependence    05030 Cocaine addiction     102405224 (JUN)    05031 Amphetamine addiction     102405224 (JUN)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102405224 (JUN)    05418 Fluid shear stress and atherosclerosis     102405224 (JUN)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     102405224 (JUN)    04933 AGE-RAGE signaling pathway in diabetic complications     102405224 (JUN)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     102405224 (JUN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:bbub03000]     102405224 (JUN) Transcription factors [BR:bbub03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Jun     102405224 (JUN) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Jun bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 ZapB PspA_IM30 Fib_alpha TFIIA ATG16 DUF3450 FlaC_arch Motif Other DBs NCBI-GeneID:  102405224 NCBI-ProteinID:  XP_006048334 LinkDB All DBs Position 6:86995188..86997902 Genome browser AA seq 335 aa AA seqDB search MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAQPVSGAGLVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGS LSSGGGAPSYGAAGLAFPAQPQQQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMP GETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAS TANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctccag tctgagagcggcgcctacggctacagtaaccccaagattctgaagcagagcatgaccctg aatctggccgacccggtgggcagcctgaagccgcacctccgggccaagaactccgacctc ctcacctctcccgacgtggggctgctcaagctggcgtcacccgagctggagcgcctaatc atacagtccagcaacgggcatatcaccaccacgccgacccccacccagttcctgtgcccc aagaacgtgacggacgagcaggagggattcgccgagggcttcgtgcgcgccctggccgaa ctgcacagccagaacacgctgcccagcgtcacgtcggcggcgcagccggtcagcggggcg ggcctggtggccccggcggtggcctcggtggcgggcggcagcggcagcggtggcttcagc gccagcctgcacagcgagccgccggtctacgccaacctcagcaacttcaaccccggctcg ctgagcagcggcggcggggcgccctcctatggcgcggctggcctggcctttcccgcgcag ccccagcagcagcagcagcaaccgccgcagccgccgcaccacctgccccagcagatcccc gtgcagcacccgcggctgcaggccctgaaggaggagccgcagacggtgcccgagatgccc ggggaaacgccgcccctgtcccccatcgacatggagtcccaggagcggatcaaggcggag aggaagcgcatgaggaaccgcatcgctgcctccaagtgccggaaaaggaagctggagagg atcgcgcggctggaggaaaaagtgaaaaccttgaaagcgcagaactcggagctggcgtcc acggccaatatgctcagggaacaggtggcccagcttaaacagaaagtcatgaaccacgtt aacagcgggtgccaactcatgctaacgcagcagttgcaaacgttttga

DBGET integrated database retrieval system