KEGG   Bubalus bubalis (water buffalo): 102405655
Entry
102405655         CDS       T05912                                 
Name
(RefSeq) calmodulin
  KO
K02183  calmodulin
Organism
bbub  Bubalus bubalis (water buffalo)
Pathway
bbub04014  Ras signaling pathway
bbub04015  Rap1 signaling pathway
bbub04020  Calcium signaling pathway
bbub04022  cGMP-PKG signaling pathway
bbub04024  cAMP signaling pathway
bbub04070  Phosphatidylinositol signaling system
bbub04114  Oocyte meiosis
bbub04218  Cellular senescence
bbub04261  Adrenergic signaling in cardiomyocytes
bbub04270  Vascular smooth muscle contraction
bbub04371  Apelin signaling pathway
bbub04625  C-type lectin receptor signaling pathway
bbub04713  Circadian entrainment
bbub04720  Long-term potentiation
bbub04722  Neurotrophin signaling pathway
bbub04728  Dopaminergic synapse
bbub04740  Olfactory transduction
bbub04744  Phototransduction
bbub04750  Inflammatory mediator regulation of TRP channels
bbub04910  Insulin signaling pathway
bbub04912  GnRH signaling pathway
bbub04915  Estrogen signaling pathway
bbub04916  Melanogenesis
bbub04921  Oxytocin signaling pathway
bbub04922  Glucagon signaling pathway
bbub04924  Renin secretion
bbub04925  Aldosterone synthesis and secretion
bbub04970  Salivary secretion
bbub04971  Gastric acid secretion
bbub05010  Alzheimer disease
bbub05012  Parkinson disease
bbub05022  Pathways of neurodegeneration - multiple diseases
bbub05031  Amphetamine addiction
bbub05034  Alcoholism
bbub05133  Pertussis
bbub05152  Tuberculosis
bbub05163  Human cytomegalovirus infection
bbub05167  Kaposi sarcoma-associated herpesvirus infection
bbub05170  Human immunodeficiency virus 1 infection
bbub05200  Pathways in cancer
bbub05214  Glioma
bbub05417  Lipid and atherosclerosis
bbub05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bbub00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102405655
   04015 Rap1 signaling pathway
    102405655
   04371 Apelin signaling pathway
    102405655
   04020 Calcium signaling pathway
    102405655
   04070 Phosphatidylinositol signaling system
    102405655
   04024 cAMP signaling pathway
    102405655
   04022 cGMP-PKG signaling pathway
    102405655
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102405655
   04218 Cellular senescence
    102405655
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102405655
  09152 Endocrine system
   04910 Insulin signaling pathway
    102405655
   04922 Glucagon signaling pathway
    102405655
   04912 GnRH signaling pathway
    102405655
   04915 Estrogen signaling pathway
    102405655
   04921 Oxytocin signaling pathway
    102405655
   04916 Melanogenesis
    102405655
   04924 Renin secretion
    102405655
   04925 Aldosterone synthesis and secretion
    102405655
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102405655
   04270 Vascular smooth muscle contraction
    102405655
  09154 Digestive system
   04970 Salivary secretion
    102405655
   04971 Gastric acid secretion
    102405655
  09156 Nervous system
   04728 Dopaminergic synapse
    102405655
   04720 Long-term potentiation
    102405655
   04722 Neurotrophin signaling pathway
    102405655
  09157 Sensory system
   04744 Phototransduction
    102405655
   04740 Olfactory transduction
    102405655
   04750 Inflammatory mediator regulation of TRP channels
    102405655
  09159 Environmental adaptation
   04713 Circadian entrainment
    102405655
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102405655
  09162 Cancer: specific types
   05214 Glioma
    102405655
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102405655
   05163 Human cytomegalovirus infection
    102405655
   05167 Kaposi sarcoma-associated herpesvirus infection
    102405655
  09171 Infectious disease: bacterial
   05133 Pertussis
    102405655
   05152 Tuberculosis
    102405655
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102405655
   05012 Parkinson disease
    102405655
   05022 Pathways of neurodegeneration - multiple diseases
    102405655
  09165 Substance dependence
   05031 Amphetamine addiction
    102405655
   05034 Alcoholism
    102405655
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    102405655
   05418 Fluid shear stress and atherosclerosis
    102405655
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bbub01009]
    102405655
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bbub04131]
    102405655
   03036 Chromosome and associated proteins [BR:bbub03036]
    102405655
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bbub04147]
    102405655
Protein phosphatases and associated proteins [BR:bbub01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     102405655
Membrane trafficking [BR:bbub04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    102405655
Chromosome and associated proteins [BR:bbub03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     102405655
Exosome [BR:bbub04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   102405655
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 AIF-1 EF-hand_9 EH SPARC_Ca_bdg EF_EFCAB10_C DUF5580_M UPF0154 FCaBP_EF-hand EF-hand_11 MTIP_N EF-hand_14 NNH6 DUF2666 ExbD Phage_TAC_12 SurA_N_3 DUF7660 Phage_portal VipE DUF3349 SurA_N_2
Other DBs
NCBI-GeneID: 102405655
NCBI-ProteinID: XP_006042947
LinkDB
Position
14:complement(40791576..40792491)
AA seq 148 aa
MAEKLSEEQVAEFKEAFDRFDKNKDGTISVQELGTVMQEVGLKPSEADLKVVISRLDTEE
NGSISFQEFLEAMAAWLQTSDMEGLREIFRAFDQDDDGYISVDELRQATSQLGEKVSQDK
LDAMIREVDVDQDGRVNYEEFVRILTQN
NT seq 447 nt   +upstreamnt  +downstreamnt
atggcagaaaagctgtccgaagagcaggtggcggagttcaaggaggcctttgacaggttc
gacaagaacaaggatggcaccatcagtgtgcaggagctgggcaccgtgatgcaggaggtg
ggcctgaagccatcagaggctgatctgaaggtggtcatctcccggctggacacggaagag
aatggcagcatcagcttccaggagttcctggaggccatggccgcatggcttcagacctca
gacatggagggcctgagggaaatcttccgtgccttcgaccaggatgacgatggctacatc
agcgtggacgagctcagacaggccacgtcccagctgggggagaaggtgtctcaggacaag
ctggacgccatgatccgggaggtggatgtggaccaagacggtcgggtgaactatgaggaa
ttcgtgcgcatcctcacccagaactga

DBGET integrated database retrieval system