Bubalus bubalis (water buffalo): 102405655 Help Entry 102405655         CDS       T05912                                  Name (RefSeq) calmodulin   KO K02183   calmodulin Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub04014   Ras signaling pathway bbub04015   Rap1 signaling pathway bbub04020   Calcium signaling pathway bbub04022   cGMP-PKG signaling pathway bbub04024   cAMP signaling pathway bbub04070   Phosphatidylinositol signaling system bbub04114   Oocyte meiosis bbub04218   Cellular senescence bbub04261   Adrenergic signaling in cardiomyocytes bbub04270   Vascular smooth muscle contraction bbub04371   Apelin signaling pathway bbub04625   C-type lectin receptor signaling pathway bbub04713   Circadian entrainment bbub04720   Long-term potentiation bbub04722   Neurotrophin signaling pathway bbub04728   Dopaminergic synapse bbub04740   Olfactory transduction bbub04744   Phototransduction bbub04750   Inflammatory mediator regulation of TRP channels bbub04910   Insulin signaling pathway bbub04912   GnRH signaling pathway bbub04915   Estrogen signaling pathway bbub04916   Melanogenesis bbub04921   Oxytocin signaling pathway bbub04922   Glucagon signaling pathway bbub04924   Renin secretion bbub04925   Aldosterone synthesis and secretion bbub04970   Salivary secretion bbub04971   Gastric acid secretion bbub05010   Alzheimer disease bbub05012   Parkinson disease bbub05022   Pathways of neurodegeneration - multiple diseases bbub05031   Amphetamine addiction bbub05034   Alcoholism bbub05133   Pertussis bbub05152   Tuberculosis bbub05163   Human cytomegalovirus infection bbub05167   Kaposi sarcoma-associated herpesvirus infection bbub05170   Human immunodeficiency virus 1 infection bbub05200   Pathways in cancer bbub05214   Glioma bbub05417   Lipid and atherosclerosis bbub05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:bbub00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102405655    04015 Rap1 signaling pathway     102405655    04371 Apelin signaling pathway     102405655    04020 Calcium signaling pathway     102405655    04070 Phosphatidylinositol signaling system     102405655    04024 cAMP signaling pathway     102405655    04022 cGMP-PKG signaling pathway     102405655  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     102405655    04218 Cellular senescence     102405655  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102405655   09152 Endocrine system    04910 Insulin signaling pathway     102405655    04922 Glucagon signaling pathway     102405655    04912 GnRH signaling pathway     102405655    04915 Estrogen signaling pathway     102405655    04921 Oxytocin signaling pathway     102405655    04916 Melanogenesis     102405655    04924 Renin secretion     102405655    04925 Aldosterone synthesis and secretion     102405655   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     102405655    04270 Vascular smooth muscle contraction     102405655   09154 Digestive system    04970 Salivary secretion     102405655    04971 Gastric acid secretion     102405655   09156 Nervous system    04728 Dopaminergic synapse     102405655    04720 Long-term potentiation     102405655    04722 Neurotrophin signaling pathway     102405655   09157 Sensory system    04744 Phototransduction     102405655    04740 Olfactory transduction     102405655    04750 Inflammatory mediator regulation of TRP channels     102405655   09159 Environmental adaptation    04713 Circadian entrainment     102405655  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102405655   09162 Cancer: specific types    05214 Glioma     102405655   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102405655    05163 Human cytomegalovirus infection     102405655    05167 Kaposi sarcoma-associated herpesvirus infection     102405655   09171 Infectious disease: bacterial    05133 Pertussis     102405655    05152 Tuberculosis     102405655   09164 Neurodegenerative disease    05010 Alzheimer disease     102405655    05012 Parkinson disease     102405655    05022 Pathways of neurodegeneration - multiple diseases     102405655   09165 Substance dependence    05031 Amphetamine addiction     102405655    05034 Alcoholism     102405655   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102405655    05418 Fluid shear stress and atherosclerosis     102405655  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:bbub01009]     102405655   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bbub04131]     102405655    03036 Chromosome and associated proteins [BR:bbub03036]     102405655   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bbub04147]     102405655 Protein phosphatases and associated proteins [BR:bbub01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      102405655 Membrane trafficking [BR:bbub04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     102405655 Chromosome and associated proteins [BR:bbub03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      102405655 Exosome [BR:bbub04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    102405655 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 AIF-1 EF-hand_9 EH SPARC_Ca_bdg EF_EFCAB10_C DUF5580_M UPF0154 FCaBP_EF-hand EF-hand_11 MTIP_N EF-hand_14 NNH6 DUF2666 ExbD Phage_TAC_12 SurA_N_3 DUF7660 Phage_portal VipE DUF3349 SurA_N_2 Motif Other DBs NCBI-GeneID:  102405655 NCBI-ProteinID:  XP_006042947 LinkDB All DBs Position 14:complement(40791576..40792491) Genome browser AA seq 148 aa AA seqDB search MAEKLSEEQVAEFKEAFDRFDKNKDGTISVQELGTVMQEVGLKPSEADLKVVISRLDTEE NGSISFQEFLEAMAAWLQTSDMEGLREIFRAFDQDDDGYISVDELRQATSQLGEKVSQDK LDAMIREVDVDQDGRVNYEEFVRILTQN NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atggcagaaaagctgtccgaagagcaggtggcggagttcaaggaggcctttgacaggttc gacaagaacaaggatggcaccatcagtgtgcaggagctgggcaccgtgatgcaggaggtg ggcctgaagccatcagaggctgatctgaaggtggtcatctcccggctggacacggaagag aatggcagcatcagcttccaggagttcctggaggccatggccgcatggcttcagacctca gacatggagggcctgagggaaatcttccgtgccttcgaccaggatgacgatggctacatc agcgtggacgagctcagacaggccacgtcccagctgggggagaaggtgtctcaggacaag ctggacgccatgatccgggaggtggatgtggaccaagacggtcgggtgaactatgaggaa ttcgtgcgcatcctcacccagaactga

DBGET integrated database retrieval system