Bubalus bubalis (water buffalo): 102408706 Help Entry 102408706         CDS       T05912                                  Symbol TXN Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub04621   NOD-like receptor signaling pathway bbub05012   Parkinson disease bbub05132   Salmonella infection bbub05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:bbub00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     102408706 (TXN)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102408706 (TXN)   09164 Neurodegenerative disease    05012 Parkinson disease     102408706 (TXN)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102408706 (TXN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:bbub03110]     102408706 (TXN) Chaperones and folding catalysts [BR:bbub03110]  Protein folding catalysts   Protein disulfide isomerase    102408706 (TXN) SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_2 DIM1 Thioredoxin_8 A6-like_Thioredoxin-like_C OST3_OST6 AhpC-TSA Thioredoxin_9 Glutaredoxin Thioredoxin_7 Redoxin PedC-like Motif Other DBs NCBI-GeneID:  102408706 NCBI-ProteinID:  XP_006048738 LinkDB All DBs Position 3:complement(161611788..161626770) Genome browser AA seq 105 aa AA seqDB search MVKQIESKYAFQEALNSAGEKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVVFLEVDVD DCQDVAAECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELI NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagcagattgagagcaagtacgcttttcaggaagccttgaacagtgcaggagag aaactcgtagtagtcgacttctcagccacgtggtgtgggccttgcaaaatgatcaagcct ttctttcattctctctctgaaaagtattccaacgtggtgttcctcgaagtagacgtggat gactgtcaggatgttgctgcagagtgtgaagtcaaatgcatgccaaccttccagtttttt aaaaagggacagaaggtgggtgaattttctggagctaataaagaaaaacttgaagccacc attaatgaattaatctaa

DBGET integrated database retrieval system