Bubalus bubalis (water buffalo): 102409692 Help Entry 102409692         CDS       T05912                                  Symbol RAB5A Name (RefSeq) ras-related protein Rab-5A   KO K07887   Ras-related protein Rab-5A Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub04014   Ras signaling pathway bbub04137   Mitophagy - animal bbub04144   Endocytosis bbub04145   Phagocytosis bbub04148   Efferocytosis bbub04962   Vasopressin-regulated water reabsorption bbub05014   Amyotrophic lateral sclerosis bbub05022   Pathways of neurodegeneration - multiple diseases bbub05132   Salmonella infection bbub05146   Amoebiasis bbub05152   Tuberculosis Brite KEGG Orthology (KO) [BR:bbub00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102409692 (RAB5A)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102409692 (RAB5A)    04145 Phagocytosis     102409692 (RAB5A)    04137 Mitophagy - animal     102409692 (RAB5A)    04148 Efferocytosis     102409692 (RAB5A)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     102409692 (RAB5A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102409692 (RAB5A)    05152 Tuberculosis     102409692 (RAB5A)   09174 Infectious disease: parasitic    05146 Amoebiasis     102409692 (RAB5A)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102409692 (RAB5A)    05022 Pathways of neurodegeneration - multiple diseases     102409692 (RAB5A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bbub04131]     102409692 (RAB5A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bbub04147]     102409692 (RAB5A)    04031 GTP-binding proteins [BR:bbub04031]     102409692 (RAB5A) Membrane trafficking [BR:bbub04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     102409692 (RAB5A)  Endosome - Lysosome transport     102409692 (RAB5A) Exosome [BR:bbub04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102409692 (RAB5A)   Exosomal proteins of other body fluids (saliva and urine)    102409692 (RAB5A)   Exosomal proteins of colorectal cancer cells    102409692 (RAB5A)   Exosomal proteins of bladder cancer cells    102409692 (RAB5A) GTP-binding proteins [BR:bbub04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     102409692 (RAB5A) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA MMR_HSR1 RsgA_GTPase AAA_16 BrnT_toxin Motif Other DBs NCBI-GeneID:  102409692 NCBI-ProteinID:  XP_006072022 LinkDB All DBs Position 1:201947946..201981613 Genome browser AA seq 215 aa AA seqDB search MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKK LPKNEPQNPGANSARGRGVDLAEPAQPARGQCCGN NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggctaatcgaggagcaacaagacccaacgggccaaatactggaaataaaatatgccag ttcaaactagtacttctgggagagtctgctgttggcaaatcaagccttgtgcttcgtttt gtgaagggccagtttcatgaatttcaagagagtaccattggggctgcttttctgactcaa acggtatgtcttgatgacacgacagtaaaatttgaaatatgggacacggctggccaagag cggtaccacagcctggcgcccatgtactacagaggcgcccaggccgccatagtcgtgtac gacatcacgaacgaggagtcctttgccagagccaaaaactgggttaaagagcttcagagg caagccagtcctaacattgtaatagctttatcaggaaacaaggccgatctggcaaataaa agagctgtcgactttcaggaggcacagtcctatgcggatgataacagtttattatttatg gagacatcagctaaaacatcaatgaatgtaaatgaaatattcatggcaatagctaaaaag ttgccaaagaacgaaccacagaatccaggagcgaactcggccagaggcagaggagtggac ctcgcggagcccgcccagcccgccaggggccagtgctgcggcaactga

DBGET integrated database retrieval system