Bubalus bubalis (water buffalo): 102409799 Help Entry 102409799         CDS       T05912                                  Symbol DYNLT1 Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub04145   Phagocytosis bbub04814   Motor proteins bbub05132   Salmonella infection Brite KEGG Orthology (KO) [BR:bbub00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     102409799 (DYNLT1)   09142 Cell motility    04814 Motor proteins     102409799 (DYNLT1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102409799 (DYNLT1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:bbub03037]     102409799 (DYNLT1)    04812 Cytoskeleton proteins [BR:bbub04812]     102409799 (DYNLT1) Cilium and associated proteins [BR:bbub03037]  Motile cilia and associated proteins   Dynein arm    102409799 (DYNLT1) Cytoskeleton proteins [BR:bbub04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      102409799 (DYNLT1) SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  102409799 NCBI-ProteinID:  XP_006051330 LinkDB All DBs Position 10:9066303..9073819 Genome browser AA seq 113 aa AA seqDB search MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKP FKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggaagactaccaggccgccgaggagactgcttttgttgttgatgaagtgagcaacatc gtaaaagaggccatagaaagtgccatcggtggcaacgcctatcagcacagcaaagtcaat cagtggaccacaaacgtagtggaacagaccttaagccaactcaccaagctggggaaacca tttaagtacatcgtgacctgtgtgatcatgcagaagaatggagcaggcctgcacacggca agctcctgcttctgggacagctccaccgacgggagctgcactgtgcgatgggagaacaag accatgtactgcattgtcagcgcctttggactgtccatctga

DBGET integrated database retrieval system