Bubalus bubalis (water buffalo): 102411013 Help Entry 102411013         CDS       T05912                                  Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub01521   EGFR tyrosine kinase inhibitor resistance bbub01524   Platinum drug resistance bbub04014   Ras signaling pathway bbub04064   NF-kappa B signaling pathway bbub04115   p53 signaling pathway bbub04137   Mitophagy - animal bbub04140   Autophagy - animal bbub04151   PI3K-Akt signaling pathway bbub04210   Apoptosis bbub04215   Apoptosis - multiple species bbub04621   NOD-like receptor signaling pathway bbub04630   JAK-STAT signaling pathway bbub05012   Parkinson disease bbub05014   Amyotrophic lateral sclerosis bbub05022   Pathways of neurodegeneration - multiple diseases bbub05145   Toxoplasmosis bbub05162   Measles bbub05166   Human T-cell leukemia virus 1 infection bbub05168   Herpes simplex virus 1 infection bbub05170   Human immunodeficiency virus 1 infection bbub05200   Pathways in cancer bbub05202   Transcriptional misregulation in cancer bbub05212   Pancreatic cancer bbub05220   Chronic myeloid leukemia bbub05222   Small cell lung cancer bbub05225   Hepatocellular carcinoma bbub05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bbub00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102411013    04630 JAK-STAT signaling pathway     102411013    04064 NF-kappa B signaling pathway     102411013    04151 PI3K-Akt signaling pathway     102411013  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102411013    04137 Mitophagy - animal     102411013   09143 Cell growth and death    04210 Apoptosis     102411013    04215 Apoptosis - multiple species     102411013    04115 p53 signaling pathway     102411013  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     102411013  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102411013    05202 Transcriptional misregulation in cancer     102411013   09162 Cancer: specific types    05212 Pancreatic cancer     102411013    05225 Hepatocellular carcinoma     102411013    05220 Chronic myeloid leukemia     102411013    05222 Small cell lung cancer     102411013   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102411013    05170 Human immunodeficiency virus 1 infection     102411013    05162 Measles     102411013    05168 Herpes simplex virus 1 infection     102411013   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102411013   09164 Neurodegenerative disease    05012 Parkinson disease     102411013    05014 Amyotrophic lateral sclerosis     102411013    05022 Pathways of neurodegeneration - multiple diseases     102411013   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102411013   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     102411013    01524 Platinum drug resistance     102411013  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:bbub01009]     102411013   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bbub03036]     102411013   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:bbub02000]     102411013 Protein phosphatases and associated proteins [BR:bbub01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      102411013 Chromosome and associated proteins [BR:bbub03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     102411013 Transporters [BR:bbub02000]  Other transporters   Pores ion channels [TC:1]    102411013 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  BH4 Bcl-2 Motif Other DBs NCBI-GeneID:  102411013 NCBI-ProteinID:  XP_044781821 LinkDB All DBs Position 2:complement(68006211..68007058) Genome browser AA seq 169 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSPFSGMKENRTETPEGRESDMETPSAISGNPSWHLA DSPAVNGATGHSRSLDARKMIPMTTVKQALREASNEFKLRCQQTFNDLTSQLHITPGTAY QSFEQDTFVELYENNTTTESQKGQQRFTCWSLTDTTVAGMVLQGLLFNS NT seq 510 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggaactagtggttgactttctctcttacaagctttcccagaaa ggatacagctggagtccgtttagtggtatgaaagaaaacagaactgagaccccagaaggg agagagtcagatatggaaacccccagtgccatcagtggcaacccatcctggcacctggca gatagccccgcagtgaatggagccactggccacagcagaagcttggacgcccggaaaatg atccccatgacaacagtaaagcaagccctgagggaggcaagcaatgagtttaaactgagg tgccaacagacattcaacgacctgacgtcccagctccacatcaccccagggacagcatat caaagctttgaacaggacacttttgtggaactctatgaaaacaatacaacaaccgagagc caaaagggccaacagcgcttcacctgctggtccctgacggacacgactgtggctggtatg gttctgcagggcttgctcttcaactcatag

DBGET integrated database retrieval system