Bubalus bubalis (water buffalo): 102412626 Help Entry 102412626         CDS       T05912                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub04024   cAMP signaling pathway bbub04062   Chemokine signaling pathway bbub04064   NF-kappa B signaling pathway bbub04210   Apoptosis bbub04380   Osteoclast differentiation bbub04620   Toll-like receptor signaling pathway bbub04621   NOD-like receptor signaling pathway bbub04622   RIG-I-like receptor signaling pathway bbub04623   Cytosolic DNA-sensing pathway bbub04625   C-type lectin receptor signaling pathway bbub04657   IL-17 signaling pathway bbub04658   Th1 and Th2 cell differentiation bbub04659   Th17 cell differentiation bbub04660   T cell receptor signaling pathway bbub04662   B cell receptor signaling pathway bbub04668   TNF signaling pathway bbub04722   Neurotrophin signaling pathway bbub04920   Adipocytokine signaling pathway bbub04926   Relaxin signaling pathway bbub04931   Insulin resistance bbub04936   Alcoholic liver disease bbub05132   Salmonella infection bbub05134   Legionellosis bbub05135   Yersinia infection bbub05140   Leishmaniasis bbub05142   Chagas disease bbub05145   Toxoplasmosis bbub05160   Hepatitis C bbub05161   Hepatitis B bbub05162   Measles bbub05163   Human cytomegalovirus infection bbub05164   Influenza A bbub05166   Human T-cell leukemia virus 1 infection bbub05167   Kaposi sarcoma-associated herpesvirus infection bbub05168   Herpes simplex virus 1 infection bbub05169   Epstein-Barr virus infection bbub05170   Human immunodeficiency virus 1 infection bbub05171   Coronavirus disease - COVID-19 bbub05200   Pathways in cancer bbub05203   Viral carcinogenesis bbub05208   Chemical carcinogenesis - reactive oxygen species bbub05215   Prostate cancer bbub05220   Chronic myeloid leukemia bbub05222   Small cell lung cancer bbub05235   PD-L1 expression and PD-1 checkpoint pathway in cancer bbub05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bbub00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     102412626 (NFKBIA)    04668 TNF signaling pathway     102412626 (NFKBIA)    04024 cAMP signaling pathway     102412626 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     102412626 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102412626 (NFKBIA)    04621 NOD-like receptor signaling pathway     102412626 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     102412626 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     102412626 (NFKBIA)    04625 C-type lectin receptor signaling pathway     102412626 (NFKBIA)    04660 T cell receptor signaling pathway     102412626 (NFKBIA)    04658 Th1 and Th2 cell differentiation     102412626 (NFKBIA)    04659 Th17 cell differentiation     102412626 (NFKBIA)    04657 IL-17 signaling pathway     102412626 (NFKBIA)    04662 B cell receptor signaling pathway     102412626 (NFKBIA)    04062 Chemokine signaling pathway     102412626 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     102412626 (NFKBIA)    04926 Relaxin signaling pathway     102412626 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     102412626 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     102412626 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102412626 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     102412626 (NFKBIA)    05203 Viral carcinogenesis     102412626 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102412626 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     102412626 (NFKBIA)    05215 Prostate cancer     102412626 (NFKBIA)    05222 Small cell lung cancer     102412626 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102412626 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     102412626 (NFKBIA)    05161 Hepatitis B     102412626 (NFKBIA)    05160 Hepatitis C     102412626 (NFKBIA)    05171 Coronavirus disease - COVID-19     102412626 (NFKBIA)    05164 Influenza A     102412626 (NFKBIA)    05162 Measles     102412626 (NFKBIA)    05168 Herpes simplex virus 1 infection     102412626 (NFKBIA)    05163 Human cytomegalovirus infection     102412626 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     102412626 (NFKBIA)    05169 Epstein-Barr virus infection     102412626 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     102412626 (NFKBIA)    05135 Yersinia infection     102412626 (NFKBIA)    05134 Legionellosis     102412626 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102412626 (NFKBIA)    05140 Leishmaniasis     102412626 (NFKBIA)    05142 Chagas disease     102412626 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102412626 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     102412626 (NFKBIA)    04931 Insulin resistance     102412626 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:bbub03000]     102412626 (NFKBIA)    04131 Membrane trafficking [BR:bbub04131]     102412626 (NFKBIA) Transcription factors [BR:bbub03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     102412626 (NFKBIA) Membrane trafficking [BR:bbub04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     102412626 (NFKBIA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  102412626 NCBI-ProteinID:  XP_006043908 LinkDB All DBs Position 20:24821587..24825037 Genome browser AA seq 314 aa AA seqDB search MFQPAEPGQDWAMEGPRDALKKERLLDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEAP RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAEALLEAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQPRGTQHLHSILQATN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQTLPESEDEESYDTESEFTEDEL PYDDCVLGGQRLTL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgttccagcctgccgagcccggccaagattgggccatggagggcccccgggacgcgctc aagaaggagcggctgctagacgaccgccacgacagcggcctggactccatgaaggacgag gagtatgagcagatggtgaaggagctgcgagagatccgcctcgagccgcaggaggcgccg cgcggcgccgagccctggaaacagcagctcaccgaggacggagactcgttcctgcactta gccattatccatgaagagaaggcgctgaccatggaagtggttcgccaagtgaagggagac ctggccttcctcaacttccagaacaacctgcagcagacgccactccacttggctgtgatc actaaccagccagaaatcgctgaggcacttctggaagctggctgtgatcctgagctgcga gactttcgaggaaatacccccctacaccttgcctgtgagcagggctgcctggccagtgtg ggagtcctgactcagccccgggggacccagcacctccactccatcctgcaggccaccaac tacaatggccacacgtgtctgcacttggcctctattcatggctacctgggcatcgtggag ctgttggtgtccttgggcgctgatgtcaacgctcaggagccctgcaatggccgaactgcc ctccatctggcagtggacctgcagaatcccgacctggtgtcactcctattgaagtgtggg gctgatgtcaacagagtcacctaccagggctactccccgtaccagctcacgtggggccgc cccagcacccggatacagcagcagctgggccagctgaccctagagaaccttcagacactg ccagagagcgaggatgaggagagttatgacaccgaatcagagttcacagaggatgagctt ccctacgatgactgtgtgcttggaggccagcgtctgacgttatga

DBGET integrated database retrieval system