Bubalus bubalis (water buffalo): 102413537 Help Entry 102413537         CDS       T05912                                  Name (RefSeq) C-C motif chemokine 3 isoform X1   KO K05408   C-C motif chemokine 3 Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub04060   Cytokine-cytokine receptor interaction bbub04061   Viral protein interaction with cytokine and cytokine receptor bbub04062   Chemokine signaling pathway bbub04620   Toll-like receptor signaling pathway bbub05142   Chagas disease bbub05163   Human cytomegalovirus infection bbub05323   Rheumatoid arthritis bbub05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bbub00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102413537    04061 Viral protein interaction with cytokine and cytokine receptor     102413537  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102413537    04062 Chemokine signaling pathway     102413537  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     102413537   09174 Infectious disease: parasitic    05142 Chagas disease     102413537   09163 Immune disease    05323 Rheumatoid arthritis     102413537   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102413537  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bbub04052]     102413537    00536 Glycosaminoglycan binding proteins [BR:bbub00536]     102413537 Cytokines and neuropeptides [BR:bbub04052]  Cytokines   Chemokines    102413537 Glycosaminoglycan binding proteins [BR:bbub00536]  Heparan sulfate / Heparin   Chemokines    102413537 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 WAP ACI44 Motif Other DBs NCBI-GeneID:  102413537 NCBI-ProteinID:  XP_006048116 LinkDB All DBs Position 3:complement(48944623..48981437) Genome browser AA seq 158 aa AA seqDB search MKLGGLFLLAGLLTLNTRLQAIGVCVEQCQEDWDCTAGEKCVSNGCGHVCSPAPQASTCI NECREDRDCGVKKECLQVGCRHVCLPLATAVGTNTPTDCCFSFVSRQIPRKFVDDYYETS SQCSKPGIIFKTKRGRQVCADPSEDWVQEYITDLELNP NT seq 477 nt NT seq  +upstreamnt  +downstreamnt atgaagttgggtggtctcttcctcctggccggtctcctcaccctcaacacaaggctccag gcaattggtgtctgtgtggagcagtgccaagaagactgggactgcacggcaggagagaag tgcgtcagcaatggctgtggccacgtgtgctcaccagccccacaagcaagcacctgtatt aatgagtgcagagaagacagggactgtggggtaaaaaaagagtgcctccaagtgggctgt cggcatgtctgcctgcctctagctacagcagttggtaccaacaccccgaccgactgctgc ttctccttcgtctcccggcagatcccgcgcaaattcgtggacgactattatgagaccagc agccagtgctccaagcccggcatcatcttcaagaccaaaagaggccggcaggtctgtgct gaccccagtgaggactgggtccaggaatacatcaccgacctggagctgaatccctga

DBGET integrated database retrieval system