Bubalus bubalis (water buffalo): 102413678 Help Entry 102413678         CDS       T05912                                  Symbol IL1A Name (RefSeq) interleukin-1 alpha isoform X1   KO K04383   interleukin 1 alpha Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub04010   MAPK signaling pathway bbub04060   Cytokine-cytokine receptor interaction bbub04217   Necroptosis bbub04218   Cellular senescence bbub04380   Osteoclast differentiation bbub04640   Hematopoietic cell lineage bbub04932   Non-alcoholic fatty liver disease bbub04933   AGE-RAGE signaling pathway in diabetic complications bbub04940   Type I diabetes mellitus bbub05010   Alzheimer disease bbub05020   Prion disease bbub05022   Pathways of neurodegeneration - multiple diseases bbub05133   Pertussis bbub05140   Leishmaniasis bbub05152   Tuberculosis bbub05162   Measles bbub05164   Influenza A bbub05321   Inflammatory bowel disease bbub05323   Rheumatoid arthritis bbub05332   Graft-versus-host disease bbub05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:bbub00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102413678 (IL1A)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102413678 (IL1A)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102413678 (IL1A)    04218 Cellular senescence     102413678 (IL1A)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     102413678 (IL1A)   09158 Development and regeneration    04380 Osteoclast differentiation     102413678 (IL1A)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     102413678 (IL1A)    05162 Measles     102413678 (IL1A)   09171 Infectious disease: bacterial    05133 Pertussis     102413678 (IL1A)    05152 Tuberculosis     102413678 (IL1A)   09174 Infectious disease: parasitic    05140 Leishmaniasis     102413678 (IL1A)   09163 Immune disease    05323 Rheumatoid arthritis     102413678 (IL1A)    05321 Inflammatory bowel disease     102413678 (IL1A)    05332 Graft-versus-host disease     102413678 (IL1A)   09164 Neurodegenerative disease    05010 Alzheimer disease     102413678 (IL1A)    05020 Prion disease     102413678 (IL1A)    05022 Pathways of neurodegeneration - multiple diseases     102413678 (IL1A)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102413678 (IL1A)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     102413678 (IL1A)    04932 Non-alcoholic fatty liver disease     102413678 (IL1A)    04933 AGE-RAGE signaling pathway in diabetic complications     102413678 (IL1A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bbub04052]     102413678 (IL1A) Cytokines and neuropeptides [BR:bbub04052]  Cytokines   Interleukins    102413678 (IL1A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL1_propep IL1 DUF4937 Motif Other DBs NCBI-GeneID:  102413678 NCBI-ProteinID:  XP_006056051 UniProt:  Q6R4R1 LinkDB All DBs Position 12:complement(46015319..46025821) Genome browser AA seq 268 aa AA seqDB search MAKVPDLFEDLKNCYSENEDYSSEIDHLSLNQKSFYDASYEPLRENQMDKFMSLDTSETS KTSRLSFKENVVMVAASGKILKKRRLSLNQFITDDDLEAIANNTEEEIIKPRSAHYSFQS NVKYNFMRVIHQECILNDALNQSIIRDMSGPYLTAATLNNLEEAVKFDMVAYVSEEDSQL PVTLRISKTQLFVSAQNEDEPVLLKEMPETPKIIKDETNLLFFWEKHGSMDYFKSVAHPK LFIATKQEKLVHMASGPPSVTDFQILEK NT seq 807 nt NT seq  +upstreamnt  +downstreamnt atggccaaagtccctgacctctttgaagacctgaagaactgttacagtgaaaatgaagac tacagttctgaaattgaccacctctctctcaatcagaagtccttctatgatgcaagctat gagccacttcgtgagaaccagatggataagtttatgtccctggatacctcggaaacctct aagacatccaggcttagcttcaaggagaatgtggtgatggtggcagccagtgggaagatt ctgaagaagagacggttgagtttaaatcagttcatcaccgatgacgacctagaagccatt gccaataatacagaagaagaaatcatcaagcccagatcagcacattacagcttccagagt aacgtgaaatacaactttatgagagtcatccaccaggaatgcatcctgaacgacgccctc aatcaaagtataattcgagatatgtcaggtccatacctgacggctgctacattaaataat ctggaggaggcagtgaaatttgacatggttgcttatgtatcagaagaggattctcagctt cctgtgactctaagaatctcaaaaactcaactgtttgtgagtgctcaaaatgaagacgaa cctgtcttgctaaaggagatgcccgagacacccaaaatcatcaaagatgagaccaacctc ctcttcttctgggaaaagcatggctctatggactacttcaaatcagttgcccatccaaag ttgtttattgccacaaagcaagaaaaattggtgcacatggcaagtgggccgccctcggtc actgactttcagatattggaaaaatag

DBGET integrated database retrieval system