Bubalus bubalis (water buffalo): 102414136 Help Entry 102414136         CDS       T05912                                  Name (RefSeq) histone H3.3A   KO K11253   histone H3 Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub04613   Neutrophil extracellular trap formation bbub05034   Alcoholism bbub05202   Transcriptional misregulation in cancer bbub05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bbub00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102414136  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     102414136   09163 Immune disease    05322 Systemic lupus erythematosus     102414136   09165 Substance dependence    05034 Alcoholism     102414136  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bbub03036]     102414136   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bbub04147]     102414136 Chromosome and associated proteins [BR:bbub03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102414136 Exosome [BR:bbub04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102414136 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  102414136 NCBI-ProteinID:  XP_006062028 EnsemblRapid:  ENSBBUG00015009943 LinkDB All DBs Position 3:26033203..26034096 Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE FLIRKLPFQRLVRDIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAERVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcccgaaccaagcagactgctcgtaagtcaacgggtgggaaagcgccccgcaagcag ctggccaccaaagcggccaggaaaagtgccccctctactggcggggtgaaaaaacctcat cgctacaggcccgggactgttgcgcttcgagaaatccgtcgttaccagaaatccaccgag tttctgatccggaaactgcctttccagaggttggtgagggatatcgcccaggatttcaaa accgacttgaggttccagagtgccgccatcggcgcgctgcaggaggctagcgaagcgtac ctggtgggtttgtttgaagatactaatctgtgtgccatccacgctgagagagtcaccatc atgcccaaagacatccagttggctcgccggatacggggagagagagcttaa

DBGET integrated database retrieval system