Bubalus bubalis (water buffalo): 102414262 Help Entry 102414262         CDS       T05912                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub04015   Rap1 signaling pathway bbub04810   Regulation of actin cytoskeleton bbub05014   Amyotrophic lateral sclerosis bbub05132   Salmonella infection Brite KEGG Orthology (KO) [BR:bbub00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     102414262 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102414262 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102414262 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102414262 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bbub04131]     102414262 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:bbub04812]     102414262 (PFN3)    04147 Exosome [BR:bbub04147]     102414262 (PFN3) Membrane trafficking [BR:bbub04131]  Others   Actin-binding proteins    Others     102414262 (PFN3) Cytoskeleton proteins [BR:bbub04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      102414262 (PFN3) Exosome [BR:bbub04147]  Exosomal proteins   Proteins found in most exosomes    102414262 (PFN3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Terminase-T7_RNaseH-like Motif Other DBs NCBI-GeneID:  102414262 NCBI-ProteinID:  XP_006042975 LinkDB All DBs Position 9:72232872..72233694 Genome browser AA seq 137 aa AA seqDB search MGDWKGYISAVLRDQRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLTGPDRSTFL QAGLCVAGRRCCVIRDHLLAEGDGVLDARTKGLDGRAICVGHTPRALLVLMGRRGVHGGI LNKTMHELIHGLRSQGT NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggtgactggaaaggttacatcagtgcagtgcttcgggaccagcgcatcgacgacgtg gccatcgtgggccactcggacaatcgctgcgtgtgggcctcgaggcctgggggcctgctg gcggccatctcaccgcaggaggtgggtgtgctcaccgggccagaccggagcaccttcctg caggccgggctgtgcgtggcaggccgccgttgctgcgtcatccgagaccacctgctggct gagggtgatggagtgctggacgcgcgcaccaagggtctggatgggcgcgccatctgcgtg ggccacacgcctcgggcgctcctcgtgctcatgggccggcggggcgtgcatgggggcatt ctcaacaagacgatgcacgagctgatccatgggctgcgctcgcagggcacctag

DBGET integrated database retrieval system