Bubalus bubalis (water buffalo): 102414399 Help Entry 102414399         CDS       T05912                                  Name (RefSeq) histone H2B type 2-E   KO K11252   histone H2B Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub04613   Neutrophil extracellular trap formation bbub05034   Alcoholism bbub05203   Viral carcinogenesis bbub05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bbub00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102414399  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     102414399   09163 Immune disease    05322 Systemic lupus erythematosus     102414399   09165 Substance dependence    05034 Alcoholism     102414399  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bbub03036]     102414399   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bbub04147]     102414399 Chromosome and associated proteins [BR:bbub03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102414399 Exosome [BR:bbub04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102414399 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  102414399 NCBI-ProteinID:  XP_006049265 LinkDB All DBs Position 6:20836245..20838584 Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgagccggcaaaatccgctcccgcgcccaagaagggctccaagaaagccgtcact aaagcccaaaagaaggacggcaagaagcgcaagcgcagccgtaaggagagctattccatc tacgtgtacaaggtgctgaagcaggtgcacccggacaccggtatttcgtccaaggccatg ggcatcatgaactcatttgtcaacgacatcttcgagcgcatcgcgggcgaagcgtcgcgc ttggcgcattacaacaagcgttcgaccatcacgtccagggagatccagacggccgtgcgc ctgctgctgcctggcgagctggccaagcacgccgtgtccgagggcaccaaggcggtcacc aagtacaccagctccaagtga

DBGET integrated database retrieval system