Bubalus bubalis (water buffalo): 102415114 Help Entry 102415114         CDS       T05912                                  Name (RefSeq) interferon alpha-B-like   KO K05414   interferon alpha Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub04060   Cytokine-cytokine receptor interaction bbub04151   PI3K-Akt signaling pathway bbub04217   Necroptosis bbub04620   Toll-like receptor signaling pathway bbub04621   NOD-like receptor signaling pathway bbub04622   RIG-I-like receptor signaling pathway bbub04623   Cytosolic DNA-sensing pathway bbub04630   JAK-STAT signaling pathway bbub04650   Natural killer cell mediated cytotoxicity bbub04936   Alcoholic liver disease bbub05152   Tuberculosis bbub05160   Hepatitis C bbub05161   Hepatitis B bbub05162   Measles bbub05163   Human cytomegalovirus infection bbub05164   Influenza A bbub05165   Human papillomavirus infection bbub05167   Kaposi sarcoma-associated herpesvirus infection bbub05168   Herpes simplex virus 1 infection bbub05169   Epstein-Barr virus infection bbub05170   Human immunodeficiency virus 1 infection bbub05171   Coronavirus disease - COVID-19 bbub05200   Pathways in cancer bbub05320   Autoimmune thyroid disease bbub05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bbub00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     102415114    04151 PI3K-Akt signaling pathway     102415114   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102415114  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102415114  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102415114    04621 NOD-like receptor signaling pathway     102415114    04622 RIG-I-like receptor signaling pathway     102415114    04623 Cytosolic DNA-sensing pathway     102415114    04650 Natural killer cell mediated cytotoxicity     102415114  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102415114   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102415114    05161 Hepatitis B     102415114    05160 Hepatitis C     102415114    05171 Coronavirus disease - COVID-19     102415114    05164 Influenza A     102415114    05162 Measles     102415114    05168 Herpes simplex virus 1 infection     102415114    05163 Human cytomegalovirus infection     102415114    05167 Kaposi sarcoma-associated herpesvirus infection     102415114    05169 Epstein-Barr virus infection     102415114    05165 Human papillomavirus infection     102415114   09171 Infectious disease: bacterial    05152 Tuberculosis     102415114   09163 Immune disease    05320 Autoimmune thyroid disease     102415114   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102415114   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     102415114  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bbub04052]     102415114 Cytokines and neuropeptides [BR:bbub04052]  Cytokines   Interferons    102415114 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  102415114 NCBI-ProteinID:  XP_006055574 LinkDB All DBs Position 3:complement(85519425..85520023) Genome browser AA seq 189 aa AA seqDB search MAPAWSLLLALQLLSCNAICSLGCHLPHTHSLANRRVLMLLQQLRRVSPSSCLQDRNDFA FPQEALGGSQLQKAQAISVLHEATQHTFQLFSTEGSATTWDQSLLDKLRTALDQQLTDLQ ACLRQEEGLRGAPLLKEDSSLAVRKYFHRITLYLQEKRHSPCAWEVVRAEVMRAFSSSTN LQERFRRKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccccagcttggtccttacttctggccctgcagctgctcagctgcaacgccatctgc tctctgggttgccacctgcctcacacccacagcctggccaacaggagggtcctgatgctc ctgcaacaactgaggagggtctccccttcctcctgcctgcaggacagaaatgacttcgca ttcccccaggaggcgctgggtggcagccagttgcagaaggctcaagccatctctgtgctc cacgaggcgacccagcacaccttccagctctttagcacagagggctcggccaccacgtgg gaccagagcctcctggacaagctccgcacggcactggatcagcagctcactgacctgcaa gcctgtctgaggcaggaggaggggctgcgaggggctcccctgctcaaggaggactccagc ctggctgtgaggaaatacttccatagaatcactctctatctgcaagagaagagacacagc ccttgtgcctgggaggttgtcagagcagaagtcatgagagccttctcttcctcaacaaac ttgcaggagagattcaggagaaaggactga

DBGET integrated database retrieval system