Bubalus bubalis (water buffalo): 102416581 Help Entry 102416581         CDS       T05912                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub01521   EGFR tyrosine kinase inhibitor resistance bbub01524   Platinum drug resistance bbub04014   Ras signaling pathway bbub04064   NF-kappa B signaling pathway bbub04115   p53 signaling pathway bbub04137   Mitophagy - animal bbub04140   Autophagy - animal bbub04151   PI3K-Akt signaling pathway bbub04210   Apoptosis bbub04215   Apoptosis - multiple species bbub04621   NOD-like receptor signaling pathway bbub04630   JAK-STAT signaling pathway bbub05012   Parkinson disease bbub05014   Amyotrophic lateral sclerosis bbub05022   Pathways of neurodegeneration - multiple diseases bbub05145   Toxoplasmosis bbub05162   Measles bbub05166   Human T-cell leukemia virus 1 infection bbub05168   Herpes simplex virus 1 infection bbub05170   Human immunodeficiency virus 1 infection bbub05200   Pathways in cancer bbub05202   Transcriptional misregulation in cancer bbub05212   Pancreatic cancer bbub05220   Chronic myeloid leukemia bbub05222   Small cell lung cancer bbub05225   Hepatocellular carcinoma bbub05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bbub00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102416581 (BCL2L1)    04630 JAK-STAT signaling pathway     102416581 (BCL2L1)    04064 NF-kappa B signaling pathway     102416581 (BCL2L1)    04151 PI3K-Akt signaling pathway     102416581 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102416581 (BCL2L1)    04137 Mitophagy - animal     102416581 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     102416581 (BCL2L1)    04215 Apoptosis - multiple species     102416581 (BCL2L1)    04115 p53 signaling pathway     102416581 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     102416581 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102416581 (BCL2L1)    05202 Transcriptional misregulation in cancer     102416581 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     102416581 (BCL2L1)    05225 Hepatocellular carcinoma     102416581 (BCL2L1)    05220 Chronic myeloid leukemia     102416581 (BCL2L1)    05222 Small cell lung cancer     102416581 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102416581 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     102416581 (BCL2L1)    05162 Measles     102416581 (BCL2L1)    05168 Herpes simplex virus 1 infection     102416581 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102416581 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     102416581 (BCL2L1)    05014 Amyotrophic lateral sclerosis     102416581 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     102416581 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102416581 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     102416581 (BCL2L1)    01524 Platinum drug resistance     102416581 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:bbub01009]     102416581 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bbub03036]     102416581 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:bbub02000]     102416581 (BCL2L1) Protein phosphatases and associated proteins [BR:bbub01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      102416581 (BCL2L1) Chromosome and associated proteins [BR:bbub03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     102416581 (BCL2L1) Transporters [BR:bbub02000]  Other transporters   Pores ion channels [TC:1]    102416581 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  102416581 NCBI-ProteinID:  XP_006064499 LinkDB All DBs Position 14:22339096..22390392 Genome browser AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESDMETSSAINGNPSWHLA DSPAVNGATGHSRSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVNRISTWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagtaaccgggagctggtggttgactttctctcttacaagctttcccagaaa ggatacagctggagtcagtttagtgatgtggaggagaacagaactgaggccccagaaggg acagaatcagatatggaaacctccagtgccatcaatggcaacccatcctggcacctggcg gatagccctgcggtgaatggagccactggccacagcagaagcttggatgcccgggaagtg atccccatggcagcggtgaagcaagccctgagggaggcaggcgatgagtttgaactgagg taccgacgggcattcagcgacctgacatcccagctccacatcaccccagggacagcatat cagagctttgaacaggtagtgaatgaactcttccgggacggggtgaactggggtcgcatt gtggcctttttctccttcggtggggcactgtgcgtggaaagcgtagacaaggagatgcag gtattggtgaatcggatctcaacttggatggccacttacctgaatgaccacctagagcct tggatccaggagaacggcggctgggacacttttgtggaactctacgggaacaatgcagca gccgagagccggaagggccaggagcgcttcaaccgctggttcctgacgggcatgactgtg gctggtgtggttctgctgggctcgctcttcagtcggaaatga

DBGET integrated database retrieval system