Bubalus bubalis (water buffalo): 112577611 Help Entry 112577611         CDS       T05912                                  Name (RefSeq) C-C motif chemokine 3   KO K05408   C-C motif chemokine 3 Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub04060   Cytokine-cytokine receptor interaction bbub04061   Viral protein interaction with cytokine and cytokine receptor bbub04062   Chemokine signaling pathway bbub04620   Toll-like receptor signaling pathway bbub05142   Chagas disease bbub05163   Human cytomegalovirus infection bbub05323   Rheumatoid arthritis bbub05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bbub00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112577611    04061 Viral protein interaction with cytokine and cytokine receptor     112577611  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     112577611    04062 Chemokine signaling pathway     112577611  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     112577611   09174 Infectious disease: parasitic    05142 Chagas disease     112577611   09163 Immune disease    05323 Rheumatoid arthritis     112577611   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112577611  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bbub04052]     112577611    00536 Glycosaminoglycan binding proteins [BR:bbub00536]     112577611 Cytokines and neuropeptides [BR:bbub04052]  Cytokines   Chemokines    112577611 Glycosaminoglycan binding proteins [BR:bbub00536]  Heparan sulfate / Heparin   Chemokines    112577611 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  112577611 NCBI-ProteinID:  XP_025136887 LinkDB All DBs Position 3:48827695..48829408 Genome browser AA seq 93 aa AA seqDB search MEVPGAALAVLLLTAALSAHTCSATLGANTPTACCFSFVSRQIPRKFVDDYYETSSQCSK PGIIFKTKRGRQVCADPSEDWVQEYITDLELNP NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggaggtccccggggccgccctggctgtcctgctgctcaccgcggccctctctgcccac acctgctctgccacccttggtgccaacaccccgaccgcctgctgcttctccttcgtctcc cggcagatcccgcgcaaattcgtggacgactattatgagaccagcagccagtgctccaag cccggcatcatcttcaagaccaaaagaggccggcaggtctgtgccgaccccagtgaggac tgggtccaggaatacatcaccgacctggagctgaatccctga

DBGET integrated database retrieval system