Bubalus bubalis (water buffalo): 112577736 Help Entry 112577736         CDS       T05912                                  Name (RefSeq) interferon alpha-H-like   KO K05414   interferon alpha Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub04060   Cytokine-cytokine receptor interaction bbub04151   PI3K-Akt signaling pathway bbub04217   Necroptosis bbub04620   Toll-like receptor signaling pathway bbub04621   NOD-like receptor signaling pathway bbub04622   RIG-I-like receptor signaling pathway bbub04623   Cytosolic DNA-sensing pathway bbub04630   JAK-STAT signaling pathway bbub04650   Natural killer cell mediated cytotoxicity bbub04936   Alcoholic liver disease bbub05152   Tuberculosis bbub05160   Hepatitis C bbub05161   Hepatitis B bbub05162   Measles bbub05163   Human cytomegalovirus infection bbub05164   Influenza A bbub05165   Human papillomavirus infection bbub05167   Kaposi sarcoma-associated herpesvirus infection bbub05168   Herpes simplex virus 1 infection bbub05169   Epstein-Barr virus infection bbub05170   Human immunodeficiency virus 1 infection bbub05171   Coronavirus disease - COVID-19 bbub05200   Pathways in cancer bbub05320   Autoimmune thyroid disease bbub05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:bbub00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     112577736    04151 PI3K-Akt signaling pathway     112577736   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     112577736  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     112577736  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     112577736    04621 NOD-like receptor signaling pathway     112577736    04622 RIG-I-like receptor signaling pathway     112577736    04623 Cytosolic DNA-sensing pathway     112577736    04650 Natural killer cell mediated cytotoxicity     112577736  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     112577736   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     112577736    05161 Hepatitis B     112577736    05160 Hepatitis C     112577736    05171 Coronavirus disease - COVID-19     112577736    05164 Influenza A     112577736    05162 Measles     112577736    05168 Herpes simplex virus 1 infection     112577736    05163 Human cytomegalovirus infection     112577736    05167 Kaposi sarcoma-associated herpesvirus infection     112577736    05169 Epstein-Barr virus infection     112577736    05165 Human papillomavirus infection     112577736   09171 Infectious disease: bacterial    05152 Tuberculosis     112577736   09163 Immune disease    05320 Autoimmune thyroid disease     112577736   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     112577736   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     112577736  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:bbub04052]     112577736 Cytokines and neuropeptides [BR:bbub04052]  Cytokines   Interferons    112577736 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  112577736 NCBI-ProteinID:  XP_025135065 LinkDB All DBs Position 3:complement(85394268..85395522) Genome browser AA seq 189 aa AA seqDB search MAPAWSLLLALLLLSYNAICSLGCHQPHSHSLANRRVLMLLQQLRRVSPSSCLQDRNDFA FPPEALGGSQLQKAQAISVLHEVTQHTFQLFSTEGSAATWDQSLLDKLRAALDQQLTDLQ ACLRQEEGLRGAPLLKEDSSLAVRKYFHRLTLYLQEKRHSPCAWEVVRAEVMRAFSSSTN LEERFRRKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccccagcctggtccctcctcctggccctgctgctgctcagctacaacgccatctgc tctctgggctgccatcagcctcactcccacagcctggccaacaggagggtcctgatgctc ctgcaacaactgaggagggtctccccttcctcctgcctgcaggacagaaatgacttcgca ttccccccggaggcgctgggtggcagccagttgcagaaggctcaagccatctctgtgctc cacgaggtgacccagcacaccttccagctcttcagcacagagggctcggccgccacgtgg gaccagagcctcctggacaagctccgcgcggcactggatcagcagctcactgacctgcaa gcctgtctgaggcaggaggaggggctgcgaggggctcccctgctcaaggaggactccagc ctggctgtgaggaaatacttccacagactcactctctatctgcaagagaagagacacagc ccttgtgcctgggaggttgtcagagcagaagtcatgagagccttctcttcctcaacaaac ttggaggagagattcaggagaaaggactga

DBGET integrated database retrieval system