Bubalus bubalis (water buffalo): 112587037 Help Entry 112587037         CDS       T05912                                  Name (RefSeq) histone H4-like   KO K11254   histone H4 Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub04613   Neutrophil extracellular trap formation bbub05034   Alcoholism bbub05203   Viral carcinogenesis bbub05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bbub00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     112587037  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     112587037   09163 Immune disease    05322 Systemic lupus erythematosus     112587037   09165 Substance dependence    05034 Alcoholism     112587037  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bbub03036]     112587037 Chromosome and associated proteins [BR:bbub03036]  Eukaryotic type   Nucleosome assembly factors    Histones     112587037 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP TFIID_20kDa Motif Other DBs NCBI-GeneID:  112587037 NCBI-ProteinID:  XP_044803351 LinkDB All DBs Position 9:43993133..43993444 Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLCNNIQGITKPALRCLARRGGVKRISGLIYKETRRVLK VFLENVIQDAVTYTEHAKRKTVTATDVVYALKRQGRTLYGLGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtccggacgcgggaaaggcggtaaaggcctggggaaaggcggcgctaagcgccaccgc aaggttctgtgcaacaacatccagggcatcactaagcctgctctccgctgcctggctcgt cgtggtggtgtgaagcgcatctctgggctcatttacaaggagacccgtagggtcctaaaa gtatttctggagaacgtgatccaggacgcggtcacctacaccgagcacgccaagcggaag actgtcaccgccaccgatgtggtctacgctctcaaacgccagggccgtaccctctacggt ctcggcggttaa

DBGET integrated database retrieval system