Bubalus bubalis (water buffalo): 112587898 Help Entry 112587898         CDS       T05912                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub04613   Neutrophil extracellular trap formation bbub05034   Alcoholism bbub05202   Transcriptional misregulation in cancer bbub05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:bbub00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     112587898  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     112587898   09163 Immune disease    05322 Systemic lupus erythematosus     112587898   09165 Substance dependence    05034 Alcoholism     112587898  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bbub03036]     112587898   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bbub04147]     112587898 Chromosome and associated proteins [BR:bbub03036]  Eukaryotic type   Nucleosome assembly factors    Histones     112587898 Exosome [BR:bbub04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    112587898 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  112587898 NCBI-ProteinID:  XP_044794210 LinkDB All DBs Position 2:20504995..20508015 Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcccgtacaaagcaaactgcccgtaaatccactggcggtaaagcgccacgcaagcag ctagctaccaaggcggctcgcaagagcgcaccggccaccggcggtgtaaaaaagcctcac cgctaccgtcctggcacggtggccctgcgcgagatccgccgctaccaaaagtccacagag ctgcttatccgtaaactgccatttcaacgccttgtgcgtgagattgcccaggacttcaag accgacttgcgctttcagagttcggcggtgatggcactgcaggaggcatgtgaagcctat ctggtgggacttttcgaggacaccaatttgtgcgctattcacgccaagcgcgttaccata atgcccaaggacatccagctagcccgtcggatccgcggggagagagcataa

DBGET integrated database retrieval system