Bubalus bubalis (water buffalo): 56055859 Help Entry 56055859          CDS       T05912                                  Symbol ND4L, H0I40_mgp06 Name (RefSeq) NADH dehydrogenase subunit 4L   KO K03882   NADH-ubiquinone oxidoreductase chain 4L [EC:7.1.1.2] Organism bbub  Bubalus bubalis (water buffalo) Pathway bbub00190   Oxidative phosphorylation bbub01100   Metabolic pathways bbub04714   Thermogenesis bbub04723   Retrograde endocannabinoid signaling bbub05010   Alzheimer disease bbub05012   Parkinson disease bbub05014   Amyotrophic lateral sclerosis bbub05016   Huntington disease bbub05020   Prion disease bbub05022   Pathways of neurodegeneration - multiple diseases bbub05208   Chemical carcinogenesis - reactive oxygen species bbub05415   Diabetic cardiomyopathy Module bbub_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:bbub00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     56055859 (ND4L)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     56055859 (ND4L)   09159 Environmental adaptation    04714 Thermogenesis     56055859 (ND4L)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     56055859 (ND4L)   09164 Neurodegenerative disease    05010 Alzheimer disease     56055859 (ND4L)    05012 Parkinson disease     56055859 (ND4L)    05014 Amyotrophic lateral sclerosis     56055859 (ND4L)    05016 Huntington disease     56055859 (ND4L)    05020 Prion disease     56055859 (ND4L)    05022 Pathways of neurodegeneration - multiple diseases     56055859 (ND4L)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     56055859 (ND4L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:bbub03029]     56055859 (ND4L) Enzymes [BR:bbub01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      56055859 (ND4L) Mitochondrial biogenesis [BR:bbub03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     56055859 (ND4L) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Oxidored_q2 Motif Other DBs NCBI-GeneID:  56055859 NCBI-ProteinID:  YP_009890086 LinkDB All DBs Position MT:10254..10550 Genome browser AA seq 98 aa AA seqDB search MSLVYMNIMMAFTISLVGLLMYRSHLMSSLLCLEGMMLSLFVMAALTILNSHFTLASMMP IILLVFAACEAALGLSLLVMVSNTYGTDYVQNLNLLKC NT seq 297 nt NT seq  +upstreamnt  +downstreamnt gtgtccctagtatacataaatattataatagcattcacaatctctcttgtaggattgcta atatatcgatcccacctaatatcctcccttctatgcctagaaggaatgatactgtcccta ttcgttatagctgctctaacaattcttaattcacacttcacgctagccagcataatacct atcatcttactggtcttcgcagcctgcgaagcggcactaggtctatctctgctagtaata gtatccaacacatatggtactgactatgtgcaaaatctcaacctacttaaatgctaa

DBGET integrated database retrieval system