Bufo bufo (common toad): 120979612 Help Entry 120979612         CDS       T07950                                  Name (RefSeq) histone H2A type 2-B   KO K11251   histone H2A Organism bbuf  Bufo bufo (common toad) Pathway bbuf03082   ATP-dependent chromatin remodeling bbuf04217   Necroptosis Brite KEGG Orthology (KO) [BR:bbuf00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     120979612  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     120979612  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:bbuf03036]     120979612   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bbuf04147]     120979612 Chromosome and associated proteins [BR:bbuf03036]  Eukaryotic type   Nucleosome assembly factors    Histones     120979612 Exosome [BR:bbuf04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120979612 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  120979612 NCBI-ProteinID:  XP_040264406 LinkDB All DBs Position 9:complement(16073298..16074930) Genome browser AA seq 126 aa AA seqDB search MSGRGKSGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLS AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TQTSKK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgtcaggacgagggaaatccggcggcaaagccagagccaaggccaagtctcgctcctct agggccgggctgcagtttccagtaggccgcgtccaccggctgctccggaaggggaattac gctgagcgggtcggggctggcgctcccgtctacctggccgccgtgctggagtacctgtcg gcggagatcctggagctggccgggaacgcggcgcgggacaacaagaagacccgcatcatc ccgcggcacctgcagctggcgatccgcaacgacgaggagctcaacaagctgctgggaggg gtgaccatcgcccaggggggcgtcctgcccaacatccaggcggtgctgctgcccaagaag acccagacctccaagaaatga

DBGET integrated database retrieval system