Bufo bufo (common toad): 120980475 Help Entry 120980475         CDS       T07950                                  Symbol RRAS2 Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism bbuf  Bufo bufo (common toad) Pathway bbuf04010   MAPK signaling pathway bbuf04137   Mitophagy - animal bbuf04140   Autophagy - animal bbuf04218   Cellular senescence bbuf04371   Apelin signaling pathway bbuf04625   C-type lectin receptor signaling pathway bbuf04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:bbuf00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120980475 (RRAS2)    04371 Apelin signaling pathway     120980475 (RRAS2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     120980475 (RRAS2)    04137 Mitophagy - animal     120980475 (RRAS2)   09143 Cell growth and death    04218 Cellular senescence     120980475 (RRAS2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     120980475 (RRAS2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     120980475 (RRAS2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bbuf04147]     120980475 (RRAS2)    04031 GTP-binding proteins [BR:bbuf04031]     120980475 (RRAS2) Exosome [BR:bbuf04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    120980475 (RRAS2)   Exosomal proteins of bladder cancer cells    120980475 (RRAS2) GTP-binding proteins [BR:bbuf04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     120980475 (RRAS2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 SLFN-g3_helicase Motif Other DBs NCBI-GeneID:  120980475 NCBI-ProteinID:  XP_040265546 LinkDB All DBs Position 10:complement(6044246..6068264) Genome browser AA seq 202 aa AA seqDB search MAGWKDGSVQDKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDERAA RLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPM VLVGNKADLEHQRQVTQEEGQQSAQQLKVTYMEASAKIRMNVDQAFHELVRVVRKFQEQE CPPSPEPTRKEKDKKGCHCVLF NT seq 609 nt NT seq  +upstreamnt  +downstreamnt atggccggctggaaggacggctcggtgcaggacaagtaccggctggtggtggtgggaggc ggcggagtgggcaagtctgcgctcaccatccagttcatccagtcctactttgtaacagac tatgacccgaccattgaggactcctacaccaagcagtgcgttatcgatgaacgcgccgcg cggctggacatcctggacaccgccgggcaggaggagttcggagccatgagagaacagtac atgaggaccggggaggggttcttactcgtcttctccgtaacggacagaggaagttttgaa gaaatctataaattccagagacagatcctccgagtaaaggatcgggatgaatttcctatg gtgctggtcgggaacaaggcagatctggagcatcagagacaggtaacgcaggaggaaggg cagcagtcggcgcagcagctgaaagtgacgtatatggaggcgtctgccaaaatccggatg aacgttgatcaagcttttcatgaactggtgcgagtagtgaggaagtttcaggagcaggaa tgccccccgtctccggagccgacgcggaaggagaaggacaagaaaggctgtcactgcgtc ctgttctga

DBGET integrated database retrieval system