Bufo bufo (common toad): 120982434 Help Entry 120982434         CDS       T07950                                  Name (RefSeq) metallothionein-like   KO K14739   metallothionein 1/2 Organism bbuf  Bufo bufo (common toad) Brite KEGG Orthology (KO) [BR:bbuf00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:bbuf03019]     120982434    03029 Mitochondrial biogenesis [BR:bbuf03029]     120982434 Messenger RNA biogenesis [BR:bbuf03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      120982434 Mitochondrial biogenesis [BR:bbuf03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     120982434 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  120982434 NCBI-ProteinID:  XP_040268502 LinkDB All DBs Position 11:47078175..47082904 Genome browser AA seq 62 aa AA seqDB search MDPQSCDCGTGASCSCEVSCKCQKCKCTSCKKSCCSCCPADCSKCRQGCQCTDGCGTCSC CK NT seq 189 nt NT seq  +upstreamnt  +downstreamnt atggaccctcagagctgtgactgcggaacaggagcttcttgttcctgtgaagtctcatgt aaatgtcagaaatgcaaatgtacctcgtgcaaaaaaagttgctgctcctgctgtccggct gactgcagtaaatgccgccagggctgtcagtgcacagatggatgtgggacctgcagctgc tgcaagtga

DBGET integrated database retrieval system