Bufo bufo (common toad): 120989276 Help Entry 120989276         CDS       T07950                                  Symbol TXN Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism bbuf  Bufo bufo (common toad) Pathway bbuf04621   NOD-like receptor signaling pathway bbuf05132   Salmonella infection Brite KEGG Orthology (KO) [BR:bbuf00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     120989276 (TXN)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120989276 (TXN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:bbuf03110]     120989276 (TXN) Chaperones and folding catalysts [BR:bbuf03110]  Protein folding catalysts   Protein disulfide isomerase    120989276 (TXN) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 AhpC-TSA Thioredoxin_9 Thioredoxin_7 OST3_OST6 Thioredoxin_2 Redoxin DIM1 Motif Other DBs NCBI-GeneID:  120989276 NCBI-ProteinID:  XP_040273208 LinkDB All DBs Position 2:complement(404168097..404192443) Genome browser AA seq 96 aa AA seqDB search MVRYVESLEEFKTALKEAGDKLVVVDFTATWCGPCKMIGPFFDSLSTKYPNVVFLKVDVD DAADIAAHCDIKCMPTFHFYKKEERVCICRFTFQNC NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggtccgctatgtggagagtctggaggaatttaagactgccctgaaagaagctggtgac aaacttgtcgttgtggacttcacagccacatggtgtgggccatgtaaaatgattggacct ttctttgattccctgagtacaaagtaccccaacgttgtgtttcttaaagtggatgtggat gatgcagcggatattgcagcacactgtgatattaaatgtatgccaacttttcacttctat aaaaaagaagaacgggtatgtatctgtcgttttacatttcagaattgttaa

DBGET integrated database retrieval system