Bufo bufo (common toad): 120994895 Help Entry 120994895         CDS       T07950                                  Symbol DYNLT3 Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism bbuf  Bufo bufo (common toad) Pathway bbuf04145   Phagocytosis bbuf04814   Motor proteins bbuf05132   Salmonella infection Brite KEGG Orthology (KO) [BR:bbuf00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     120994895 (DYNLT3)   09142 Cell motility    04814 Motor proteins     120994895 (DYNLT3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120994895 (DYNLT3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:bbuf03037]     120994895 (DYNLT3)    04812 Cytoskeleton proteins [BR:bbuf04812]     120994895 (DYNLT3) Cilium and associated proteins [BR:bbuf03037]  Motile cilia and associated proteins   Dynein arm    120994895 (DYNLT3) Cytoskeleton proteins [BR:bbuf04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      120994895 (DYNLT3) SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 AAA_lid_SMAX1 Motif Other DBs NCBI-GeneID:  120994895 NCBI-ProteinID:  XP_040279706 LinkDB All DBs Position 3 Genome browser AA seq 115 aa AA seqDB search MEDHQHKAENTFSGDEASSIVKECVEVILGGVDYDDSRVNEWMSAVVEQSLTHLVKMEKA FKYIVTCTVMQKRGGGLHTASSSFWDNSTDGSCTVRWENRTMYCIVNVFAVAIHL NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atggaggaccaccagcacaaggcggagaacactttcagtggagatgaagcgagcagcatt gtcaaagagtgtgtagaagtcatcctgggtggagtagactacgatgatagtagagtcaat gagtggatgtcagccgttgtggaacagtctttaacccatctagtaaagatggaaaaagcc tttaaatatatcgtaacctgtacagtcatgcagaaaagaggaggtggtcttcacactgca agttcctcattttgggataactccactgatggtagctgcacagtgcgatgggaaaaccgg accatgtactgcattgtcaacgtctttgctgtggccatacacctataa

DBGET integrated database retrieval system