Bufo bufo (common toad): 120994996 Help Entry 120994996         CDS       T07950                                  Symbol NRAS Name (RefSeq) GTPase NRas isoform X1   KO K07828   GTPase NRas Organism bbuf  Bufo bufo (common toad) Pathway bbuf04010   MAPK signaling pathway bbuf04012   ErbB signaling pathway bbuf04068   FoxO signaling pathway bbuf04137   Mitophagy - animal bbuf04140   Autophagy - animal bbuf04150   mTOR signaling pathway bbuf04210   Apoptosis bbuf04218   Cellular senescence bbuf04370   VEGF signaling pathway bbuf04371   Apelin signaling pathway bbuf04540   Gap junction bbuf04625   C-type lectin receptor signaling pathway bbuf04810   Regulation of actin cytoskeleton bbuf04910   Insulin signaling pathway bbuf04912   GnRH signaling pathway bbuf04916   Melanogenesis Brite KEGG Orthology (KO) [BR:bbuf00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120994996 (NRAS)    04012 ErbB signaling pathway     120994996 (NRAS)    04370 VEGF signaling pathway     120994996 (NRAS)    04371 Apelin signaling pathway     120994996 (NRAS)    04068 FoxO signaling pathway     120994996 (NRAS)    04150 mTOR signaling pathway     120994996 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     120994996 (NRAS)    04137 Mitophagy - animal     120994996 (NRAS)   09143 Cell growth and death    04210 Apoptosis     120994996 (NRAS)    04218 Cellular senescence     120994996 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     120994996 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     120994996 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     120994996 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     120994996 (NRAS)    04912 GnRH signaling pathway     120994996 (NRAS)    04916 Melanogenesis     120994996 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bbuf04131]     120994996 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bbuf04147]     120994996 (NRAS)    04031 GTP-binding proteins [BR:bbuf04031]     120994996 (NRAS) Membrane trafficking [BR:bbuf04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     120994996 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     120994996 (NRAS) Exosome [BR:bbuf04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120994996 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    120994996 (NRAS)   Exosomal proteins of breast cancer cells    120994996 (NRAS)   Exosomal proteins of colorectal cancer cells    120994996 (NRAS) GTP-binding proteins [BR:bbuf04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     120994996 (NRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N TPP_enzyme_M Motif Other DBs NCBI-GeneID:  120994996 NCBI-ProteinID:  XP_040279863 LinkDB All DBs Position 3:complement(216064637..216096536) Genome browser AA seq 210 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINSYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAQELARSYGIPFVETSAKTRQSFWPKHWRSCSPQEDQNSNATCTRLFKQHL HLTNRLPHSWMVLSLCVHLPHSCCLVAPTC NT seq 633 nt NT seq  +upstreamnt  +downstreamnt atgacggaatataaactagtggtggtgggagctggaggtgttggaaaaagtgccttaact atccagcttattcagaaccattttgtggatgaatatgatcctaccatcgaggattcttac cggaagcaggttgtgattgatggggagacctgcttgctggatatcttagatactgcgggg caagaagagtatagcgcaatgcgcgaccagtatatgcgcactggggaaggctttctttgc gtctttgcaatcaacaatagcaaatcgtttgctgatataaattcctatagggagcagata aaaagagtgaaagactcagatgatgttcctatggtgcttgttggtaacaaatgtgatctg ccgacaaggactgtagacaccaaacaggcccaagaactagcccgaagttatgggatccca tttgttgagacatcagcaaaaacaagacagtctttttggccaaagcactggaggtcttgc tctccacaagaagaccaaaactcaaatgccacctgcacaagactgttcaaacagcatctc cacttgacaaatcgtttacctcattcatggatggtcttatcactgtgtgtgcacttacca catagctgctgccttgtggcccctacatgttaa

DBGET integrated database retrieval system