Bufo bufo (common toad): 120998795 Help Entry 120998795         CDS       T07950                                  Symbol MTLN Name (RefSeq) mitoregulin   KO K29035   mitoregulin Organism bbuf  Bufo bufo (common toad) Brite KEGG Orthology (KO) [BR:bbuf00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:bbuf03029]     120998795 (MTLN) Mitochondrial biogenesis [BR:bbuf03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Other regulator of mitochondrial biogenesis     120998795 (MTLN) SSDB OrthologParalogGFIT Motif Pfam:  MTLN LapA_dom DUF3429 Motif Other DBs NCBI-GeneID:  120998795 NCBI-ProteinID:  XP_040285568 LinkDB All DBs Position 4 Genome browser AA seq 56 aa AA seqDB search MADVSERGLYAAVLLSFAAGVLVGWQASRQRRRYLDWKKKRLQDKLVETQKKLDLS NT seq 171 nt NT seq  +upstreamnt  +downstreamnt atggcagacgtgtctgagcgcgggctgtacgctgcagtgctgctcagcttcgccgccgga gtgctggtcggctggcaggcgagcagacagcgcaggagatacctggactggaagaaaaag aggctgcaggacaaactggtggagacccagaagaagctagacctgtcctaa

DBGET integrated database retrieval system